SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB5876 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB5876
Domain Number 1 Region: 126-282
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.14e-21
Family Leech intramolecular trans-sialidase, N-terminal domain 0.04
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.66e-16
Family Protein kinases, catalytic subunit 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243090.RB5876
Sequence length 328
Comment (Pirellula sp)
Sequence
MAPEQIAQETQLLDGRCDVHALGVLLFELLSGRSPFQSRTQNGLREQILFRQPTLLRSAD
PSLPKELEAICSKALAKHPADRHESAAEFATELRNWLERASNRRRITWIVMVILLLLALV
TGVLIALSGGGSETNGTIQDGVMNFDGRTRVVTNLERTLPVTLEAWIKPDQYTDENCQFI
IGSDIPGEYGLGIALCGSLLSVEHVEGMVNSSAAVVPGVWSHVAAVFTKTDTRLFLNGEL
VATASGSSKGGSTNFVIGNVGQDKLLDFFRGQIRSVRVSSGERYGEVFEPSNLSRDQTTL
LLLNETASVRDESILDQDGEMLGTVEGH
Download sequence
Identical sequences Q7UR56
NP_866943.1.48053 243090.RB5876 gi|32473949|ref|NP_866943.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]