SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB6432 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB6432
Domain Number 1 Region: 60-275
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.72e-22
Family Pentraxin (pentaxin) 0.093
Further Details:      
 
Weak hits

Sequence:  243090.RB6432
Domain Number - Region: 296-380
Classification Level Classification E-value
Superfamily Cytochrome c 0.000488
Family monodomain cytochrome c 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243090.RB6432
Sequence length 903
Comment (Pirellula sp)
Sequence
MSASGLSITLRDLADQPMVNERRIAIGLSWCAVVATTCGAMLLVTASPAFAADTYRVSVG
LSAFYTFEEGRGDTVKDRSGSGKSLDLKIEKPSAVSWEDDALVVRSATKIESVHPATKLA
EQTKQSNAWTIEAWIKPANASQKGPARIVSMSNNSVQRNFTLGQERDQYQVRLRATSTSE
NGLPETASGTAKVGTKLSHVVFTRQSDGGVNFYVDGEQTASRKVAGQLSNWDGGFPLILA
NERTSERPWLGEFHLVAIYSRSLSDAEVSQNYAAGPKAGIDPHEAQRRARVKAEQTFATK
VAPLFARHCLECHDSISKKGDLDLSRKVDAMAGGESGKVILPGDADRSPLWEQIVSGDMP
PQGPGLSPSDQAVIKEWIDDGAVWSIHTIDPAVYASKPGASDHWVQRLTVPEYIETVRSA
VGVDISEEAKRLLPPDLRADGFSNTAYNLSVDLKHVEAYSQLAEVIVQRMDVLEFAKRFS
KSQSLNTDATARKFVASAGEWLLRGPLDDREVVNYSGVLTAVASAGGDYEQGVGLMVEAM
LQSPRFIYRIERQPDGGGSRRVTDFELASRMSYILWGGPPDAVLMKAARDGRLTDKDRCR
AEVERMLKDRRAIERSKQFAIDWLNLSRLTNMQPNPERFPDWTPELGIDMHAETLAFFEE
LVWKQERPMSDLFDAQFTYATPRLAKHYGWKPQGNGLRRYDLSSEPVRGGLLTQGSVLTI
GGDDASMVTRGLFVMRDLLRGVIGAPPPGVDTTPVPPKPGMTHRDVAEDRIQNESCGGCH
IKFESLAFGLEQFDGLGAFHLKDEFGNQLRSEGQLVVPGEAKPQPYETPADLMKLLSTSD
RVRETLTWKVTQFAMGRPLGARDVTEVERIHQAATGAGGRYADVVTAVVMSDLVQKTRSQ
DEP
Download sequence
Identical sequences Q7UQA7
NP_867252.1.48053 243090.RB6432 gi|32474258|ref|NP_867252.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]