SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB695 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB695
Domain Number 1 Region: 265-710
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 7.85e-123
Family Arylsulfatase 0.000034
Further Details:      
 
Weak hits

Sequence:  243090.RB695
Domain Number - Region: 65-230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0739
Family Hypothetical protein YesU 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243090.RB695
Sequence length 889
Comment (Pirellula sp)
Sequence
MNRIALSLLAFVMCFCTDHVVAGELEPQQHAWHAKYKGQDNAPLPEEMLLNTDSEPDLSE
GFTSLFNGKDLSGWTAKGGSCTFEVKDGILVGQVVPGSNSTYLSTERDDFDDFIFTCDMK
WEESCNSGVMFRAQSKPGKNGTETVFGPQAEMEGFTQDRHWSGGIYGQSCGGYFYPLWLK
EHKEARAATTEDIWNRVTISAQGNVVKTWINGVPAAHWIDDGSYPKGFFGLQVHKGAKGT
VLWKNIRVKELENEPAATPNASASKRPNVLFILADDLGWSDTTLFGTTKLYQTPNIERLA
KRGMTFTRAYSSSPLCSPTRASVLTGLSPARHGITSPTCHLPKVVLEPKVSETGPPNKFS
TVPESVTRLDTKYYTLAEMFRDNGYATGHFGKWHLGPEPYSPLEHGFDVDVPHHPGPGPA
GSYVAPWKFKDFDHDPVIPDEHLEDRMAKEAVRFLEQHTNEPFFLNYWMFSVHAPFDAKK
ELIEEYRDRVDPKDPQRCPTYAAMIESMDDAIGTLLDTLDRLGIADETIIVFASDNGGNM
YNEVDGTTATSNAPLRGGKATMYEGGVRGPAIVVQPGVVESGSRSDAIIQSIDFYPTLLE
MLAIDAQPNQRFDGVSIVPALQGKPLQRDAIFTYFPHDPPVPNWMPPSVSVHQGDWKLIR
IFHGGPNGSHRYKLFNLKNDLGERINLAAKHPDRVQQMDKLIGQHLVETKAVRPLVNKNF
DPAKYNAGAEGKGNLKRSGNKPKKGKQRVQRKPVAGWLPGGTCDLSVANSVLRVSSTGGD
PHLSFSLPEVVKASTMTFTVEMQSKSSGSGQVFWKEVGQPYSAERSQVFDVTHDGNVHTY
SIQLSPQGPVQGVRIDPSNGAGQIEIRQMRLLDGNGVPIHEWNFADAGR
Download sequence
Identical sequences Q7UYD6
NP_864032.1.48053 gi|32471039|ref|NP_864032.1| 243090.RB695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]