SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB8750 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB8750
Domain Number 1 Region: 35-236
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-28
Family Beta-D-xylosidase C-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243090.RB8750
Sequence length 365
Comment (Pirellula sp)
Sequence
MSRRRLRFRFGVIVVTSIFLGTWVAGSDSFAEEPDTLFFDGFDGKVDTLWNPLRPDPDRV
SLTSHPGKLTLKTHFGGLGGNALTRRMPLTRNLYLVPNPVEGDDDFVVTTCVESFRPVKN
YQQAGVMIYDDDDNYLKFDYEHSGAEAGFKHMREKDTYRLVDTDEFMEPADRLWLRVIKR
GNVYERAFSTDGEKYKVIGEAVWGDGSPQQIGIMACNGALRDHEIEAQFDFFQIRKLTAE
ERQDPVYLQRQELAGAWDVVSTKVSGQDLLESPITEFNFDGGNVSFVIQGQLTEVDYLLN
VESKPKGFTMSSLTVGAKEPVNGNYSIDDGQLILCLSLPPGTPAPNKLETLENDDHILLT
LKRSR
Download sequence
Identical sequences Q7UML5
243090.RB8750 gi|32475531|ref|NP_868525.1| NP_868525.1.48053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]