SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB92 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB92
Domain Number 1 Region: 459-680
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-20
Family Clostridium neurotoxins, the second last domain 0.055
Further Details:      
 
Domain Number 2 Region: 155-440
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 0.00000000000000234
Family Purple acid phosphatase-like 0.091
Further Details:      
 
Weak hits

Sequence:  243090.RB92
Domain Number - Region: 108-127
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 0.0366
Family Purple acid phosphatase, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243090.RB92
Sequence length 685
Comment (Pirellula sp)
Sequence
MIQLDTLAFHPAIQLTRLSQYIMPPHRICPIVLCFSCMLLMIAVPTASHANDVVGPLVGS
IDSTSAQLLYRAGASEQPLQLSVLQEGDVVQRITSIGGEQDDYVAKFSVTNLQPDTVYHY
QIDDADTQATLIKPDGQHFFRTTNPKREGHRVSVGFVSCVDIEPNGIWKEMQTLDLDMVC
LMGDTPYIDSTDLAKVRSRHRQFLQMSDLAELSGNTSTVGTWDDHDFGRNNGNGRNLSKG
KADTRRGFVNYRAHSQYGNATEGVYHKSDLGMMEVFFLDPRYFSQTEPSPVDASQPTCFG
SEQWTWLLTELRDSKAPFKVLAFGAIWEDKKNKETDDMFTYWYERDALLDIIRNENISGV
VLLGGDIHVARHLIHPQRTGYDLNDFVISPGHKRTITELDVFHPSLEWSLVEGWQFLTLT
ADGTTDEPLLTAEFRQPDGIVNRKVELPLTSLTANEEKHPNRRAHWSFDENMKNDSTLGH
RIDAVAENGARIDNNGLSGGALRLDRSKQQYIRIPRSFLDDNSPHHTVSLWFKPTSLPKH
GTSERHFLFESTAEGEVSAKTAWHLSLGMRSSESPDQINLQLYTHTLQPAKQPEAAPEAK
SQGGFDSLVARESLLGRWNQITLTFDSKTLKLSLNEQQIAKHTLPVSGPASEFGGLVIGG
HREGTGRNFDGWIDEVSVWQGQTGQ
Download sequence
Identical sequences Q7UZA1
NP_863711.1.48053 243090.RB92 gi|32470718|ref|NP_863711.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]