SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243159.AFE_0374 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243159.AFE_0374
Domain Number 1 Region: 105-186
Classification Level Classification E-value
Superfamily SMR domain-like 1.83e-18
Family Smr domain 0.0045
Further Details:      
 
Weak hits

Sequence:  243159.AFE_0374
Domain Number - Region: 37-48
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00246
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243159.AFE_0374
Sequence length 192
Comment (Acidithiobacillus ferrooxidans ATCC 23270)
Sequence
MGRRRPDQPEEQKRVTGVDDTACFLQAVADVRPLPAPPPPPRPAPPPPLPIQRHQDELAV
LEALDGGLHSDEILESGDGWLYLRPGLSPALLRDLRRGRFRIQERLDLHGCTVEEGRAEL
SAFLREARQRRWTCVCIIHGKGLGSPGRIPVLKRLVGGWLMRHQEVLAFAQARPEEGGGG
ALRVLLGWPRRE
Download sequence
Identical sequences B5EMB9 B7J4C4
243159.AFE_0374 380394.Lferr_0544 WP_012536115.1.13253 WP_012536115.1.28209 WP_012536115.1.49158 WP_012536115.1.90948 gi|218666212|ref|YP_002424877.1| gi|198282684|ref|YP_002219005.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]