SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243159.AFE_2268 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243159.AFE_2268
Domain Number 1 Region: 141-224
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.000000000000366
Family TolA 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243159.AFE_2268
Sequence length 237
Comment (Acidithiobacillus ferrooxidans ATCC 23270)
Sequence
MNTIVGSPTWTPPPLNTNKEHFGRALLVGAVLEALLVGGLIWVGSNTPPPKPVIKKIIAI
HMVRPVPPKPKPVPPPPKPIVHPKPLPRPVPLPKPVVHQVPVPKPLIAKTPLPLAPVAPP
RPPVVLPPPPPPAPSMAARQAALAEYAALVRAQVQADAHVPEAIRLMHLSGTAVITFRLA
PSGRLQWAKISRSSGAGPIDRAALKSVKEGQYPPFSKDMPKHATNFTVEVHLSGRAS
Download sequence
Identical sequences B5EL50 B7J5Q5
gi|198284022|ref|YP_002220343.1| gi|218667735|ref|YP_002426666.1| WP_012537091.1.13253 WP_012537091.1.28209 WP_012537091.1.49158 WP_012537091.1.50737 WP_012537091.1.90948 243159.AFE_2268 380394.Lferr_1915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]