SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243159.AFE_3275 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243159.AFE_3275
Domain Number 1 Region: 294-417
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.6e-27
Family Histidine kinase 0.0026
Further Details:      
 
Domain Number 2 Region: 202-276
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000124
Family Homodimeric domain of signal transducing histidine kinase 0.00081
Further Details:      
 
Domain Number 3 Region: 166-216
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000314
Family HAMP domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243159.AFE_3275
Sequence length 420
Comment (Acidithiobacillus ferrooxidans ATCC 23270)
Sequence
MNKSHLWPDTLFTRMFLIIAGLLLLSQLAVYWFFNIYQANPQAERLAQNWAQILTLSETL
TPAQRQETESVLLHQGLRIVPAGAVRGHNPRLPVLANALQLLHHMGWPQAQLRVDGQRRM
LWLQTRPDATLALAMPMLHPPGLPLPWFKLAAILLLSWLGAYLAVRQVTRPLTRLMQGVA
RLRGGDTPADLPEAGPADLRRLAERFNQTLRDLHRLWKEREMVLVGVSHDLRTPLTRMRL
SAEFLPAEEEARSEIIANIQEMDKVIHQFLDYARSGEQEALVATDLGLWLKAFILRQPAG
VVWHPPAIALPKIPIQEVGLARALQNLVDNAQSHGGAPIEVSAEPAADGVLIRVRDHGPG
IAEAELEAVRAPFAQAGKGGGVGLGLAIVERIVAYHHGRFVLVNAPGGGLEARIVLPPAP
Download sequence
Identical sequences B5ERL1 B7JBF3 F8XU94
gi|218666234|ref|YP_002427628.1| gi|198284943|ref|YP_002221264.1| 243159.AFE_3275 380394.Lferr_2873 WP_009567373.1.13253 WP_009567373.1.28209 WP_009567373.1.49158 WP_009567373.1.50737 WP_009567373.1.90948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]