SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243164.DET0283 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  243164.DET0283
Domain Number - Region: 345-400
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0268
Family Laminin G-like module 0.072
Further Details:      
 
Domain Number - Region: 250-335,440-479
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.097
Family WD40-repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243164.DET0283
Sequence length 586
Comment (Dehalococcoides ethenogenes 195)
Sequence
MKKFIIAVSMFVMSVLIGPGTILASDITDAIYRADIRATNSSYTAMKVSAPFTWSTQSLL
DGYYINSGFTNLALRDSIGNDIPFMPGQGSDPWIMWIDQIAQNSVLNYSLYTGGETAMGG
KLAYFPDTAGMSVVDSASLELGSDFEIELSGYINTSSGTSKLIIDKGGAYICYPNNAGEI
VALIGSAANISQATYYSATTSRVYGANWYGQTFIPISDIYVNSITLWCQKILAPSGNFNV
YIYAVSGGVPTGTALATGSISASTISGSAGAQTFYLSQSAKLSSGTSYALAFSCPTGDAS
NYIKVWSENSDAYASGTKCSSSDSGVTWSADSYDYYFVVGGYTPAVTLTATGIISSDHTV
KTVLSGGTFSLYVDNILADSAAYAGSITDNANNWVIGANGSMPYLYYAKITIGGVLKGSW
EWQYATTFTDLSGNSNDATPSFRTTTTDADVSAAIISYNAYNLSALVVSGDDKGIQIIDD
DEISDTPAGFFGALDPDRLEFLSPINEIISEAGIPLEFVWYPFIFGGGAAITMISFGVTR
KLLPCIIAGGIWTGFLSAALGADLWTVLPFVVVAATELVNRKTVSL
Download sequence
Identical sequences Q3Z9R8
243164.DET0260 243164.DET0283 243164.DET0893 WP_010936063.1.69666 gi|57234315|ref|YP_181619.1| gi|57234904|ref|YP_181031.1| gi|57234951|ref|YP_181008.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]