SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243164.DET0292 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243164.DET0292
Domain Number 1 Region: 363-570
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-26
Family Clostridium neurotoxins, the second last domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243164.DET0292
Sequence length 756
Comment (Dehalococcoides ethenogenes 195)
Sequence
MLRRLVKFISVIVLLAGLIIQPAASVTAADQLTVHFERIYESPVSVTFRVTITNEGKALP
DLPLEVLFDGLNVSDLSRLTITELTINEYQVSYPTQFETIEESYTATGKLVLSIDASGQT
LYQDVSLPVMDKSGNLVSSGGEIIKSGAYDRIDQKTGTVYWFTDIPVAWQTSTIQEIIPI
ELADWTAKSKSLKDNKLKTSISLPEKSLEKNPKGDTGWGSGTRVWDVTLSLPLLTTDSGW
GSQGLMKWDLAGTIYYDDTNSSWWNNNWLYRRFIALDMTTISETLTNFPVYIKLDSTNFD
FSRAQDNGEDIRFTDGVSNLDYEIVSWDSVSETAEIYVKNPVQLANVATDGIYMYYGNKA
VSDGQNPAGVWSNGYVAVYHMSDASSTLINSSVGSLPGTKSGDMAAQTAGLLGYAQYFDG
INDQIIVAYNAILDITSGSVEAIILPDSAGTDGYIFAKGNPALGYYCNTRYIGSINRIEW
AGPSAVQSNNVFTDTDWTYISFTCNGRAISFYHNGTAAGSQTLSSDPDTNTDGLYIGNRM
GGSSGSTYFDGLIDELRISGVVRSAAWLAATNLNLMSPDTFLIFGTEEGKPADPANLSAD
ISGNNIELTWVKGDLSLSTVIVRGSLHYPESPDDGLVVYDGPAESFTDTGAAGELSTHYY
RAWGYSGWGYSDGYSQDRTEGIMIGVIITLGLIAIAYIKRDIIMTIIAGISLLLLGYGII
DPDIGGNAIIQALPIILMSVYMIIRAAIYATNRREV
Download sequence
Identical sequences Q3Z9Q9
WP_010936072.1.69666 gi|57234344|ref|YP_181628.1| gi|57234887|ref|YP_181040.1| gi|57234934|ref|YP_181017.1| 243164.DET0269 243164.DET0292 243164.DET0902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]