SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243164.DET0970 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243164.DET0970
Domain Number 1 Region: 296-465
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.92e-45
Family Ribonuclease PH domain 1-like 0.00000664
Further Details:      
 
Domain Number 2 Region: 7-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.47e-42
Family Ribonuclease PH domain 1-like 0.0000328
Further Details:      
 
Domain Number 3 Region: 450-557
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.28e-27
Family Ribonuclease PH domain 2-like 0.00027
Further Details:      
 
Domain Number 4 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.7e-26
Family Ribonuclease PH domain 2-like 0.002
Further Details:      
 
Domain Number 5 Region: 605-690
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.77e-23
Family Cold shock DNA-binding domain-like 0.00028
Further Details:      
 
Domain Number 6 Region: 553-619
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000284
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 
Domain Number 7 Region: 239-317
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000811
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243164.DET0970
Sequence length 720
Comment (Dehalococcoides ethenogenes 195)
Sequence
MITANSFERTIGGRKLTIESGKMARLADAAVTIRYADTELLVTLCAAKKPREGVDFLPLT
IDYEERMYAAGKIPGGFIRREGRPSEQAILAGRLTDRPLRPLLPKEWRNELQIIITVIAS
DKENDADIWGVVGASTVLTMSQIPYEGPVGASRVGYTNGEFVLNPTFAQLEQSQMDLVVV
STRKAVVMIEAGSKEIPEDLMIKAIEFAHQANQELIDLQDEIRAKLGKEKLPVPVLEIPE
EVKAAVAAFVKGRVNEALSHQDKTLRENAVEALQSELVEALAETYAEGDILAAYDKEIKK
AIRSTILEKDIRVNGRGIKQLRQLDAETGILPRVHGSALFTRGDTQVMAITTLGSLQEAQ
QLDGLSAEDTKRFMLHYNFAPFSTGEVKRSGSPGRREIGHGALAERALVPVLPTPEEFPY
TIRMVADVVGSSGSTSMGSVCSSSLSLMDAGVPVKKAVAGISIGLITGENDTYCTITDIE
GIEDNYGDMDFKVAGTRDGITAIQVDMKVKGISFDVIRDAIYQAKEARYTILEVMDKALA
QPKTELSPYAPRMYKISIDPSKIGSVIGSGGKTIRSIIEQTNTTVDIENDGTVVIGATDE
ASAQKAIKIIEDLTKDVEAGSVYTGKVTRIMTFGAFVEILPGKEGMVHISELADHRVEKV
EDVVKVGDEITVKVTEIDSQGRINLSRRVILNPNAVPISRNRDSQPRRSGPFRPQDRSNS
Download sequence
Identical sequences Q3Z7V6
243164.DET0970 gi|57234211|ref|YP_181693.1| WP_010936672.1.69666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]