SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243164.DET1279 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243164.DET1279
Domain Number 1 Region: 3-81
Classification Level Classification E-value
Superfamily ACP-like 3.8e-18
Family Acyl-carrier protein (ACP) 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243164.DET1279
Sequence length 86
Comment (Dehalococcoides ethenogenes 195)
Sequence
MATVFERVKKVSVEQLGAEEKDVVPAASFADDLGADSLDQVELIMALETEFGTPDAKFEI
PDTDAEKLKTVQAVVDYLKSKGIKDS
Download sequence
Identical sequences A0A0V8M2Y5 Q3Z708
WP_010936968.1.26930 WP_010936968.1.40429 WP_010936968.1.4711 WP_010936968.1.69666 WP_010936968.1.98386 243164.DET1279 gi|57233931|ref|YP_181991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]