SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243164.DET1608 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243164.DET1608
Domain Number 1 Region: 321-479
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.3e-28
Family HD domain 0.027
Further Details:      
 
Domain Number 2 Region: 216-304
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.38e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243164.DET1608
Sequence length 527
Comment (Dehalococcoides ethenogenes 195)
Sequence
MLEFFMETAPTTTTGLPLSAILAIFFSFIIGIVFGGMALFVFRGFIMNRQLRIAQRKATK
MLADSKVEAKDVLVEAKREADKARNSAEAELKERRSELAKQENRVMQKTEALDRKLENLE
QREQSLTNREKSIDETQSQIEEIRTAELKRLEEVASMTTEQAKSSLLEMLEGEMQQETSR
RLREWEIKIKAEADEKAREIVSQAIQRCASDVVTETTTNVVPLPSDEMKGRLIGREGRNI
RALEQATGVDLIIDDTPEAVTISSFDPVRREIARQALSKLIIDGRIHPARIEEVVAKAKE
EVEAAMIASGEQAAYQAGVHGLRPEIIKVMGRLKYRTSYGQNVLQHSIEVAQMSGMIGSE
LGVNVTLARRAGFLHDIGKAVDRDVEGTHTQIGADMVKQWEKSPEVIKGVAEHHFDTPTV
SIWGFIVSAADAISSARPGARRESLENYIKRLKALEEIADSFKGVEKSFAIQAGREVRIM
VKPEEIDDLGAMRLARDIVKKIEDGLEYPGQIKVTVIRETRSVDFAK
Download sequence
Identical sequences A0A0V8LXJ1 Q3Z646
2014737941 gi|57233607|ref|YP_182303.1| 243164.DET1608 WP_010937279.1.26930 WP_010937279.1.40429 WP_010937279.1.4711 WP_010937279.1.69666 WP_010937279.1.98386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]