SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243230.DR_2046 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243230.DR_2046
Domain Number 1 Region: 2-71
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 4.76e-28
Family Ribosomal L11/L12e N-terminal domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 66-139
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 6e-27
Family Ribosomal protein L11, C-terminal domain 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243230.DR_2046
Sequence length 144
Comment (Deinococcus radiodurans)
Sequence
MKKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIY
ADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSV
EAAANTVAGTARSMGVTVEGGPNA
Download sequence
Identical sequences Q9RSS7
1nkwG gi|15807040|ref|NP_295769.1| 1nkw_G 1nwx_G 1nwy_G 1sm1_G 1xbp_G 2zjp_F 2zjq_F 2zjr_F 3cf5_F 3dll_F 3pio_F 3pip_F 4io9_F 4ioa_F 4ioc_F 5jvg_F NP_295769.1.55610 WP_010888678.1.45201 WP_010888678.1.61927 WP_010888678.1.86829 243230.DR_2046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]