SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243230.DR_2063 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243230.DR_2063
Domain Number 1 Region: 328-522
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.67e-47
Family Ribonuclease PH domain 1-like 0.0000115
Further Details:      
 
Domain Number 2 Region: 40-173
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.59e-41
Family Ribonuclease PH domain 1-like 0.0000382
Further Details:      
 
Domain Number 3 Region: 485-583
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.59e-29
Family Ribonuclease PH domain 2-like 0.0000925
Further Details:      
 
Domain Number 4 Region: 174-262
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.76e-27
Family Ribonuclease PH domain 2-like 0.0026
Further Details:      
 
Domain Number 5 Region: 643-721
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.45e-20
Family Cold shock DNA-binding domain-like 0.00071
Further Details:      
 
Domain Number 6 Region: 587-662
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000657
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243230.DR_2063
Sequence length 810
Comment (Deinococcus radiodurans)
Sequence
MPQLKGRAGAGASAFRWMFLSPEQPQARLPPMIGKTFTTMLGGRELSIETGKLAKLVSGS
VTVRYGDTLLLVTAQASDTQSKLDFLPLTVEFEERHYAVGKIPGSFQRREGRPGEKAILS
ARITDRQIRPLFPKGYRHETQVIITVLSADGQNAPDVLGPIGAAAALSISDIPWAGPTAC
VRVGQIDGQYVVNPTTEQLTRSRMDLVVAGTREAVMMVECGAQTVSEDDLVGAIEFAHAE
MQGVIALIEQMRAEVGHEKFNFLAEEGPANDYVPELTEKAKAAGLRDALLTHGKKDRSAR
LKALRNGLIEGYVPDPTAEGSAELTQALKDAFGKVEKRELRRLILEENLRADGRDSKTVR
PIWIEARPLPTAHGSAVFTRGETQVLGVTTLGTERDEILIDDLTAESGDKFLLHYNFPPY
STGEVKRMGGQSRREIGHGNLAKRAIRAVLPSFEEFPYVIRVVGDVLESNGSSSMGTVCA
GTLSLMDAGVPLKAPVAGVAMGLVMEGDNYRVLTDILGLEDALGDMDFKVCGTAEGVTAL
QMDIKVGGITPQIMREALAQAKEGRLHILGKMAEVLAAPRAELSPTAPHILSLKINPELI
GKVIGPGGKQVRELEAMGAQVTIEEDGTVRIFSASGESAEAVKARIEAVTKEAKVGEEFE
GTVVKIAPFGAFVNLFPGQDGMLHISQLSEQRVENVEDVLTVGDKLKVKIANIDDRGKID
LIRPELEGKVPLREPRAPRGGDRGPRRDSDRGGDRGPRREFSDRGPRPEGARSERPEGQR
TERPATAPATQESSQSSDAPAAPVFPRRED
Download sequence
Identical sequences NP_295786.1.55610 WP_010888694.1.45201 WP_010888694.1.61927 WP_010888694.1.86829 243230.DR_2063 gi|15807057|ref|NP_295786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]