SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243231.GSU0911 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243231.GSU0911
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.94e-41
Family Ferredoxin domains from multidomain proteins 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243231.GSU0911
Sequence length 159
Comment (Geobacter sulfurreducens)
Sequence
MQKLIRVEPAKCVGCKSCELACSFRHRGEFAPSKARIVNEVFLEEAKFITVTCMQCDDPW
CLKACPKGAIAKDAASGVVAVDELKCVGCRTCVSACPFGMIKYLPETRKADKCTLCAPDV
PECVIFCPTHCLTFAEEDAPLRAKVLKFVQTVKDGQMEV
Download sequence
Identical sequences Q74EQ1
243231.GSU0911 NP_951965.1.89865 gi|39996014|ref|NP_951965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]