SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243231.GSU1593 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243231.GSU1593
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4e-50
Family Ribonuclease PH domain 1-like 0.000025
Further Details:      
 
Domain Number 2 Region: 295-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.64e-48
Family Ribonuclease PH domain 1-like 0.0000156
Further Details:      
 
Domain Number 3 Region: 448-546
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.93e-29
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.54e-25
Family Ribonuclease PH domain 2-like 0.0017
Further Details:      
 
Domain Number 5 Region: 552-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.31e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0048
Further Details:      
 
Domain Number 6 Region: 618-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.36e-20
Family Cold shock DNA-binding domain-like 0.00055
Further Details:      
 
Domain Number 7 Region: 237-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 5.23e-20
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243231.GSU1593
Sequence length 697
Comment (Geobacter sulfurreducens)
Sequence
MTEHKVNVEFGGRTITIATGKWAKQASGAVVVSCGDTVVLVTAVATKSAREGQDFFPLTV
NYQEKAYAGGKIPGGFFKREGRPSDNETLTSRFIDRPIRPLFPESFLNDTQIMATVVSAD
QDNDPGILAMIGASAALEVSDIPFLGPIAGVKVGRVDGQFVCNPTVEQLEKSDLEIVVAA
SRDAVIMVEGGAAEASEKDVLEAIFFGHAAVQPIIEAQTDLRKLAGVPKREVAATSVDEA
LKTRVKDLAYAGIKEAVRIVAKQERHNRIGEITAQTLETLLPEYEGRESEIKGFLGDFEY
ELVREHIIKDGYRIDGRDTTTIRPISIEVSMLPRAHGSALFTRGETQALVASTLGTSIDE
QRIDSLYGETRKRFLLHYNFPPFSVGETSFRLAPGRREIGHGMLAERALERVVPKHEDFP
YTIRIVSDILESNGSSSMATVCGGALAMMDAGVPIKAPVAGIAMGLIKEGEGIAILSDIL
GDEDHLGDMDFKVAGTEAGVTAIQMDIKITGVTREIMEKALLQARDGRLHILGKMNQAIA
APRTDLSPYAPRITTIWVKTDKIRDVIGSGGKNIRGITEATGVSIDIEDSGRINIASTSK
EACDKAIKMIRDLTAEAEEGKLYMGTVKKVMDFGAFVEIFPGTDGLVHISELDTERVKNV
TDVLNEGDKVLVKCIGIDKQGKIKLSRKEALGAVLPE
Download sequence
Identical sequences Q74CS9
243231.GSU1593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]