SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243232.MJ0497 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243232.MJ0497
Domain Number 1 Region: 5-115
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 2.07e-28
Family Hjc-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243232.MJ0497
Sequence length 133
Comment (Methanococcus jannaschii)
Sequence
MRHKYRKGSSFERELKRLLEKEGFAVIRSAGSKGVDLIAGRKGEVLIFECKTSSKTKFYI
NKEDIEKLISFSEIFGGKPYLAIKFNGEMLFINPFLLSTNGKNYVIDERIKAIAIDFYEV
IGRGKQLKIDDLI
Download sequence
Identical sequences Q57920
WP_010869998.1.84152 gi|15668674|ref|NP_247473.1| 243232.MJ0497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]