SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243232.MJ1396 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243232.MJ1396
Domain Number 1 Region: 1467-1676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.17e-34
Family Legume lectins 0.0022
Further Details:      
 
Domain Number 2 Region: 1808-2005
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.55e-31
Family Legume lectins 0.0043
Further Details:      
 
Domain Number 3 Region: 2342-2540
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000604
Family Galacturonase 0.035
Further Details:      
 
Domain Number 4 Region: 2250-2364
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000265
Family Galacturonase 0.028
Further Details:      
 
Weak hits

Sequence:  243232.MJ1396
Domain Number - Region: 2056-2247
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000157
Family Galacturonase 0.056
Further Details:      
 
Domain Number - Region: 2502-2700
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0659
Family Galacturonase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243232.MJ1396
Sequence length 2894
Comment (Methanococcus jannaschii)
Sequence
MKSYLKNISIFVFTILLLSNVSLGLNVSTTNNNSNFELNNSLIYKLNNSLTNTTNNSGSI
IINNTTDTNKEKNECYLNITINGYRVIVKTNGEVFGFANKTPLKFIKIGDNEYIISPIVL
NVPIEIYSKFNDKILHRTVILNYTKPEKEKKETNIKKEELHYLNVSFNNFKLIVKTNGKP
YAKYLDLNIKVKTKKIKKHEYLVYPLILNKTIIIYAKFKNETLNRTIFLNYSIEENTTTN
KTVILKNVYFPSEKIVIKTNFKPHTAYIVTPNNKIIHLKVHKKGKFYILSTKLKKNVILG
NYSVVVDGIKKTFAVDYYKINAKLIDNRFIVGNVSYYVKEPKFITCIVDKKEINISLING
AFEIPLDYLIPKLNISKPEKIKKIILICGNAKEKIKVKFKNKEEIKKLISYDPVNKEIII
KLEGSEKEIKKLLKRYEKRKKYKISKIVKIYNYSIVEIKLKADKEILKDYNLPENILNTT
EIVKKISSNKIRVEVNNKVDGVWYRFSCKIPKGYRVKEIVGDDGRVIRNNISINRLTGEV
IGEVRWYIENNTLYFYDDPIYGYDISLIPPAPNHSIAVELSYNGQDYGGCGQISAIVFPY
NKEDDETTVATYDHAGRTGDYNYANNIDAYAGSKIAIKYTSGALTRQYGVLGTAGSLGWW
TYYYLSEINRTDIPLNTVPNGILESVIITDMYAPWNNNELNITQKVIIRGNNKWFATIYY
IKNPTTKTYTNLKFFQGMDWNFRGSWWGDDAYYNSIDDVVYGYDSNAPVGDIQYGGFKSN
IPSYEHDVNLYWSTWSDIRYDNLNNDSSYEGDAGTALAWTKDSLKPGEIWVVPIIWGLGY
NYTDMMNEINMGLSQLYDTGVKSIDYPNNGDSFNPNIGPIIYINSTIALYGLVDAYNLNV
SINITQINGTYIYTNSTLINLSVPYEEEKLVSFPVNISNMPYGAYNITIKTNLPNDQNTS
NDEKSIIIYITSFSVQPNYQEKTGNVGEEIFYNITLYNFGVGGRFDINITYLTKGWTTKI
YNNSILIAEDANGDGIWDYINPNYDLNSNNLPDIYVPTGEINLTVSKTIPSTAPLGEIDT
TTLKFVNINNPSIFGKTTFQTSTPYPPSVQKTFYLHGDTLRTLNTSIPTTINNYTTINSN
SLASWIQYPRFADNFTVVGKIPILLYINDPNVIFGTEMHKIVVSLMATNGIDSFTLGSDV
EYLYLDDTIKSYIFNITLDSIITIPKNYYLVLRVENQISSNSINIYHNSTYPSNITLNTT
TYVNVYNIFSDKNVYLPNENVTIFANITDPIGSYDISGANITVYYPNGSVYINSSMLLQE
IDKNSPSLWKLYNYSFSLPESGKYLITITGIESNGVISKKNYTIYCGYEIQGYVKEDFGT
LGKEDSEDKGIYGVNVSLLEDSNNDGIPDIGDTIVNSTTTDIFGHYSFLVYNSSKTYFVV
VNSRTVGTTRGLNPQYSKNDIWAEETYQTVYTPINSSQWIANGNASIFPDKLLLTTDDYG
EAGSVWYYKPVNLSEDLVVEFYAYLGDNPDGADGITFTLQSLGTNELGGTGGDLGYGGIS
PSVAVEVDTWLNDFDAPATTDHIAIDVNGNINHTYNSLTYPTPNPYDLGNVEDGREHLIK
IVWNATTKTLQVYFDGNLSLTWNKDITQIIGNSAYFGFTGGTGGAKNLQYVKPIYVKNGD
GYIINPTYGVVEMFGGRDPNEEDNWEDGKYEHYCLINLNSYSGKNITFGFSFDVITNTKS
TGQGSFSQFIKNANAIYGKDESYFRIPNIDAKNGNHYIYTSGNKILDNLTIVNGSTQING
TIILSGLQWIANGNAYINNSNNLTLILTPDDYNQKGSVWYYKPVNLSEDLVVEFYAYLGD
NPDGADGITFTLQSLGTNELGGTGGDLGYGGISPSVAVEVDTWLNDFDSPATTDHIAIDV
DGNLNHTYNSLTYSTPNPYDLGNVEDGREHLIKIVWNATTKTLQVYFDGNLALTWNKDIT
QIIGNSTYFGFTGGTGGAKNLQYVKPTYVKNGDNVLNLEEISPNPIIDNVGADTYIGNIF
FENVSVGILGNETGLNNLTLKSCGIYGKILNAGVKLVDYDWSLQNYPLYIDNLTINASGG
YGISMLNKIWAMLYNSQISLKNGVGIYWANWAGGFGNITIYNITISSCNQGLVLYKDGNG
IKLINSQIKNSVYEGVYSKNSTLEILNSSIINNSIGIYANISSILVNNSLIYKNRYEGLL
LENSSSSILNSNIMNNSIGIYLKENYISKIQKSNISYNAYGIEIVNSSNVYINSSNIFNA
STDGIAIFNGENVSVENSLLYNNNYSILSYGNLSNLSVLNSLLRDSINNSIDIEVPSDGF
LNNLKLYNSSVLNSGSYGLFIYSLGSASNVNISKSLINGSYKDGIYIYGVNAINIVNNNI
TNNGLIGGDPAGSGIKISGNYTKGVLILNNNISHNLGNGISLEGLWSRTLCDVKVENNII
SNNGIEENSGNGIYIGGRVENVSIFNNTIQYSDAQAILIQEANGWNSWDWIGTNISIINN
TIQYNGLTVTIGNITAGITVGAYGVYNQDNGYIIIEGNKIINNNLCPNPTYGGKVGGIEV
YGLNESWISLEFNISKNIIANNSAYGILIGASKDINIINNTIFNNEKGITIPNWDFVPYN
IIISKNSIYNNSLLGIDLDDDNVTLNDGLLNYNEANHGIDYPIITYAELNGDNLTVKGYI
GNGTGSSNFANAVVEIYLVKNLSGGDNLIGNNISSDGTVLNDTYGESWIYLGSLIADSNG
FFSGTINVSGKGVGDESLLTATATIKGIGTSEFGRNYLLIKKFFNITGTIVMLPNGYNIT
IKSYNTTRDVYVYWYKPDNIEVINISGDYDENGTYGNTYWFKFNVINANETMNISITTNI
TTVEGLIIGIDPKK
Download sequence
Identical sequences Q58791
WP_010870913.1.84152 gi|15669586|ref|NP_248399.1| 243232.MJ1396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]