SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243233.MCA0982 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243233.MCA0982
Domain Number 1 Region: 55-175
Classification Level Classification E-value
Superfamily HSP20-like chaperones 9.72e-35
Family HSP20 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243233.MCA0982
Sequence length 176
Comment (Methylococcus capsulatus Bath)
Sequence
MAKKEAHEKESTGKEVKAAEPVATRAYPSPWEEMERWMEQVFPAGWLEHEPWALMRRPWP
SLFRTGLSGVRVPKVDVIDRADEVVVRAELPGITKDDLEVTLSEDMFTLQASSQSESKEE
KGQYFYREMSRGEFSRSLRLPCAVDADKAKASFKDGILEVVIPKAAGSKRQSIKID
Download sequence
Identical sequences Q60A86
WP_010960286.1.29143 WP_010960286.1.63079 WP_010960286.1.70908 gi|53804919|ref|YP_113461.1| 243233.MCA0982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]