SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243233.MCA1360 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243233.MCA1360
Domain Number 1 Region: 309-509
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.49e-49
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000424
Further Details:      
 
Domain Number 2 Region: 841-1036
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.49e-46
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000423
Further Details:      
 
Domain Number 3 Region: 136-183,287-343
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 8.72e-24
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0022
Further Details:      
 
Domain Number 4 Region: 39-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.62e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00019
Further Details:      
 
Domain Number 5 Region: 682-731,818-867
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.88e-22
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0011
Further Details:      
 
Domain Number 6 Region: 732-815
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 2.75e-19
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00069
Further Details:      
 
Domain Number 7 Region: 184-284
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.18e-18
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00038
Further Details:      
 
Domain Number 8 Region: 576-681
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.88e-18
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243233.MCA1360
Sequence length 1054
Comment (Methylococcus capsulatus Bath)
Sequence
MISKFFIERPIFANVIAIVTIILGAVSLINLPVAQYPDIVPPTIQVTTRYPGASAEIIAN
TVGIPIEQAVNGVENSLYLSSTSGSDGSYTLTVTFRVGSDLNTGLALVQNMVNGALAQLP
DAVQKQGVTVKKVSTDMLQVISLYSDDDRFDETYLSNYAVINLQYPLARIHGVGQIKVVG
AGSYSMRVWLNPERLRYYGLTAKDVADAIQQQNVEVVAGQLGGPPVPEDQPYQFTINALG
RLSDVSEFENIIIKTSRGKPQQSVTNEDAARIVRVKDLARVELSQQTYTNYAEVNGHKST
QIVVYTLPGANAIDVGERIKQSMEEMSQDFPQGLKYAIFYDTTKFIDQSIHAVYETLFEA
GVLVLIVIMVFLQNWRATLVPATTVPVTIIGAFAAMAMLGFSVNLMTLFALILAIGIVVD
DAIMIVENAWHYIEKGLTPKEASIKAMSEMTGPVIGITLVLTAVFLPSAFLPGITGQMFR
QFALVIASTAIISAINALTLKPAQCALYLKARPADHRPNAFYRGFNEVYAAIEAAYTRVV
RWMVKRAGTMAVVFFAFIAMGGWLFSIHPTGFLPSEDQGYAIIMTRLPDGAAQPRLREAS
RRLDEVLKKTPGVHAWVVIGGLSILDTANLSNASTTFVIYDDWDKRGEALDQRHILGSLK
KQLDAIPEAQFAIMIPPPIRGLGQAGGFQMMVEDRRSLGLPELQKGVQELTRAGSTQSGL
GFVGSTFSNRSPQLYLDIDRTKAQSQEVPLSNVFATLQAYLGSAYVNLFNKFNQSFQVYV
QADAPYRLRPEDIENLYVKNVREEMVPLGSLLTVKHMLGSELVTRYNLYPAAPVFGSAAP
GSSSGEAIQLMERIAKNTLPQGMSFEWTATAFQEKQLGNQAYYIYLLSIVLVFLVLAAQY
ESWASPAAVILVVPMALVGVIVALIIRHFDNNLYTQVGLVLMIALASKNAILVVEFAREL
RTEGMAIADAAVEATRRRFRPIIMTSFAFILGVVPLMKAGGAGAASQQAIGTVVFGGMLA
STILAIPFVPVFYVITQRWSERNKGGKPESPATG
Download sequence
Identical sequences Q608X6
gi|53804522|ref|YP_113821.1| WP_010960640.1.29143 243233.MCA1360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]