SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243265.plu1292 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243265.plu1292
Domain Number 1 Region: 4-205
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.29e-70
Family LplA-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243265.plu1292
Sequence length 209
Comment (Photorhabdus luminescens)
Sequence
MQHKTIFLRQLGIQPYEPISDAMHLFTEQRDTNTPDEIWLVQHPKVFTQGQAGKAEHLLS
LGDIPVIQSDRGGQVTYHGPGQQVMYVMIDIKRARIGVRQLVTAIEDTVIKTLAHFGVKA
YARPDAPGVYVNEAKICSLGLRIRKGCSFHGLALNIAMDLEPFQRINPCGYAGMKMIQLS
DLVPGITVEQVQPVLVEKFCQQLGFKLNS
Download sequence
Identical sequences 243265.plu1292 gi|161579572|ref|NP_928603.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]