SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243265.plu4525 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243265.plu4525
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-48
Family Ribonuclease PH domain 1-like 0.0000155
Further Details:      
 
Domain Number 2 Region: 293-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.02e-47
Family Ribonuclease PH domain 1-like 0.0000141
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.82e-30
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 4 Region: 450-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.84e-27
Family Ribonuclease PH domain 2-like 0.0000959
Further Details:      
 
Domain Number 5 Region: 554-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.37e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 6 Region: 612-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.79e-21
Family Cold shock DNA-binding domain-like 0.000032
Further Details:      
 
Domain Number 7 Region: 238-320
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.66e-20
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243265.plu4525
Sequence length 709
Comment (Photorhabdus luminescens)
Sequence
MLNPIVRKFQYGQHTVAIETGMMARQATAAVMVNMDDTAVFVTVVGQKKVKEGQDFFPLT
VNYQERTYAAGRVPGSFFRREGRPGEGETLVARLIDRPLRPLFPDGFLNEVQIVATVVSV
NPQVNPDIVAMIGASAVLALSGIPFNGPIGAARVGYINDQYVLNPTSDELKNSRLDLVVS
GTAGAVLMVESEADILTEEQMLGAVVFGHEQQQVVIDNINALAAEAGKEKWNWVPESVNQ
ALHDRVAGLAEDRLGDAYRITEKQERYAQVDAIKEEVTAALLEQDEALEEAEIHEILGSL
EKKVVRSRVLRGEPRIDGREKDMVRALDVRTGVLPRTHGSALFTRGETQALVTATLGTER
DAQIIDELMGERTDRFLLHYNFPPYSVGETGMMGSPKRREIGHGRLAKRGVAAVMPKANE
FPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEDDNFVVLSD
ILGDEDHLGDMDFKVAGSCEGISALQMDIKIEGITREIMQIALNQAKGARLHILSVMEQA
INSPRNDISEFAPRIHTIKINPDKIKDVIGKGGSVIRALTEETGTTIEIEDDGTVKIAAT
DGEKAKHAISRIEEITAEIEVARIYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVE
KVADYLQVGQEVSVKVLEIDRQGRVRLSIKEATVGVIVEDTPVAPQSAE
Download sequence
Identical sequences Q7MYZ0
WP_011148601.1.100813 gi|37528344|ref|NP_931689.1| 243265.plu4525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]