SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243272.MARTH_orf414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243272.MARTH_orf414
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.66e-42
Family Ribosomal protein S13 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243272.MARTH_orf414
Sequence length 122
Comment (Mycoplasma arthritidis 158L3 1)
Sequence
MARVLNVEIPNKKRAVISLTYIFGIGKTLASQILKDANVDENKKVESLSEEELTRIREEA
KKYVTEGDLRREINLNIKRLMEIKSYRGIRHRKGLPVRGQCTQKNARTRKGPRKTIAGKK
GK
Download sequence
Identical sequences B3PMM3
gi|193216737|ref|YP_001999979.1| WP_012498232.1.28547 243272.MARTH_orf414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]