SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243272.MARTH_orf515 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243272.MARTH_orf515
Domain Number 1 Region: 67-292
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.18e-67
Family Pseudouridine synthase RsuA/RluD 0.0000137
Further Details:      
 
Domain Number 2 Region: 10-58
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.000000000667
Family Pseudouridine synthase RsuA N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243272.MARTH_orf515
Sequence length 298
Comment (Mycoplasma arthritidis 158L3 1)
Sequence
MLKMIVTYSERIDKYIANNSEITRNDIQALIVQGAVFVNSTKINKNKYIVHENDEIEIIK
LLDKQQNIEAQNLPLEIVYECDDYLVINKPSGLVVHPAPGHSSGTLVNSLMYHFKNNLSD
VNGLLRMGIVHRIDKDTSGLLLVAKNNETHNYFAKLLKNHEIKRTYYAIVDGHIENRLIN
LDLPIGRDPNNRQKFAVTEQNSKEAFTALEVIKYLNLAGQNKTLVKCNLKTGRTHQIRVH
LAYIKHPVYGDPVYNKKVDDFNQRLHAKELDFVDKSGKIMHFESELPQIMLNELMASE
Download sequence
Identical sequences B3PMT2
243272.MARTH_orf515 gi|193216796|ref|YP_002000038.1| WP_012498291.1.28547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]