SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243273.MG_293 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243273.MG_293
Domain Number 1 Region: 4-224
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.88e-51
Family Glycerophosphoryl diester phosphodiesterase 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243273.MG_293
Sequence length 244
Comment (Mycoplasma genitalium)
Sequence
MHNKQLLLAHRGYSFIAPENTKLAFDLAFEYCFDGIELDVHLTKDEQLVIIHDETTLRTA
LVNKEVEFESLVSLKRDDHSAFFHLKIQFQSILTLKEFLDLYLDKFKLINIEIKTDQKPY
LGIEKKLVDLVKGYGKKAIDKILFSSFNFESLQKVYDLDNSYKKGFLFWTKKQFETISTA
RIQKICQFLHPWTKIYEKYPQMIKKLNLPLNLWTVNSQNKFQQFLADNHVYAQIANKKFE
IKIN
Download sequence
Identical sequences P47535
gi|402551607|ref|YP_006600326.1| WP_010869413.1.12138 WP_010869413.1.22713 WP_010869413.1.81660 WP_010869413.1.95915 gi|402551117|ref|YP_006599837.1| gi|402552111|ref|YP_006600829.1| 243273.MG_293 gi|12045149|ref|NP_072960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]