SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243274.TM0648 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243274.TM0648
Domain Number 1 Region: 23-118
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000000236
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243274.TM0648
Sequence length 132
Comment (Thermotoga maritima)
Sequence
MYEEYIRAWVERKKKEEEKMKLLAHKALEEARKVTGVLREKYGAKRVVLFGSLAKYLRGA
GEFTERSDIDLAVEGLPKEEYFRVLSEINRLSEFEVDLIDLEGCPAFLRSLIEREGMEIE
EGTDSLTDSGDR
Download sequence
Identical sequences Q9WZB6 R4P126
gi|15643413|ref|NP_228457.1| 282520 APC4314 NP_228457.1.35502 WP_004081150.1.29620 WP_004081150.1.45724 WP_004081150.1.51363 WP_004081150.1.56403 WP_004081150.1.79805 gi|15643413|ref|NP_228457.1| 243274.TM0648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]