SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243275.TDE0237 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243275.TDE0237
Domain Number 1 Region: 307-459
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.69e-31
Family HD domain 0.0069
Further Details:      
 
Domain Number 2 Region: 201-292
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243275.TDE0237
Sequence length 509
Comment (Treponema denticola ATCC 35405)
Sequence
MNWILYVILPAVCIILGWTIRWLYARFQLSASEQRAERILQEAIKDAEAQKKEFLLEAKE
QLIREQKQQERENRERRSDLQRFERRLAQKEEVLDKRVETVEKQEKELIKREAALDERTE
ILSGEEERYREELERISGLTQQQAKDLIIRDLEAEAKHDAVTIINKIEQEAQLTAEKKAQ
DILITTIQRLATETASDITVSTVSLPSDEMKGRIIGREGRNIRALETLTGVDIIIDDTPE
AVVVSCFDPVRKEIARVALERLILDGRIHPARIEEIVQKVTREISQKVYEEGEKVLFDLG
IHNMNQEGVRALGRLYFRTSYGQNVLQHSKEVAIIAGMIASEIGANVEIAKRGALLHDIG
KGAETDSDKNHAEIGMELAKRINEDPRVVNAVGAHHNDIEPTCIESVIVQIADAISAARP
GARRETMDNYVKRLENLEQLAEGFNGVEKAYAIQAGRELRVVINNEKISDADTKILARDI
AKKIENDLQYPGRIRVTLIRETRIVEYAR
Download sequence
Identical sequences M2CQG2 Q73R54
gi|42525755|ref|NP_970853.1| NP_970853.1.36654 WP_002681149.1.22144 WP_002681149.1.94299 TdR62 243275.TDE0237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]