SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243275.TDE0446 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243275.TDE0446
Domain Number 1 Region: 99-274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000218
Family Clostridium neurotoxins, the second last domain 0.067
Further Details:      
 
Domain Number 2 Region: 394-484
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000963
Family Fibronectin type III 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243275.TDE0446
Sequence length 499
Comment (Treponema denticola ATCC 35405)
Sequence
MSLIFFNLLLISAFSEDAVLNFGGKLGWNNLFYSRNIEQRNGKFGFQSLGLTSASHNITE
TTDMYLSFDFKDTIEETGNYTVANSSIIHLGAEKAKIGEGAALFHYNSNNESLTLKPSKT
SFFAGTKILKSFTIEFWLCPQTTESGSTILRWWTSLVEGRKTMYQNIAASIFNNKLEWSF
LNIWQDKNNKGLDVRLSGKSNIIPEIWSHHLITYDETTGLLEYRMNGKSEAIVYMTETGR
ESNQVLYSALGTSSDVLIGLNYSGLIDELKVTNFFSQFGMPWEISSLFEKYPQDGGRIET
NIIDTGGNKSQPRVLKALYDKPEQTDAEFFIRAADSPFNWNGTYPEWKSIRPNEEIKNIS
GRFFQIACNIYPDAEGLKSPLIHSFSLEYEKDNLPLPPSKLIARAGDSSVELFWSPSIDT
DVKGYLIYFGNKKGEYFVEGSPIDVGNVISYKIENLKNGKIYFFAIAAYDEENGEHAGDT
SKEVWARPLQSKKEGKNVE
Download sequence
Identical sequences Q73QJ7
NP_971060.1.36654 243275.TDE0446 gi|42525962|ref|NP_971060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]