SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243277.VC0414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243277.VC0414
Domain Number 1 Region: 277-430,461-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-22
Family Legume lectins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243277.VC0414
Sequence length 1252
Comment (Vibrio cholerae)
Sequence
MNKWLAKTLVGLGCFALLSAYALAFQDIDHSIYFPSVVQGHGSCSGAPNPQLIQYNSARI
NGTNNSVVDFCSINATNERPNTRCDNNLCQVSGNTVPSLSLAGINAFKTSSVSGTEIGWC
NSGQSILLSKTNIGTVQLYASCTLSFTGQTEYKIKSLDMGSGATLVLSSGDYWIESLQLN
QGGEVVVDGDVRLFIRNNSDWNSAQINVSGSGNLTIVGYNNITLNQSNQVKAYLYVGGTL
TLHNTSVINGRVTSRRLFMEANTEINQNEQQGYACFTDDFNRSSLGQNWIPYTSSGNFTP
SIISNRMRLTEAITNQATAVTYQRIFPAAGNLVTVEFDYYAWANLTGNGADGVSVIFSDA
TVTPRTGGFGGSLGYAQRTDTNPDTPGFAGGWLGVGLDEWGNYSNATEGRQGGPGFRQQA
VAIRGSESANYQYLVGTAANLNPKLDVRRTCQWWGCSFSGAGPGHRYFITIDSRSGGGVW
VRVDRSVNGTMQTVIDWHNVLSNPNQGATPADFLLSLAGSTGASVNNHEIENFKVCALKS
RPVGQLIDHFRFTLPQQGLTCSASEVQIKACANDNCSQLYTDPVTATLSPNSAPSATGGW
LGGSQVNFNNGIATAQLRRNSVGNVSVNVLGSTPASKPFQVNLCSYTNNPNSYSTANCTV
NFADSGFIVDVPNAYANQTVTGTIKAVRKDNASQQCLPSFGNVQKSVAFWSEYLNPTANN
SGFQSVSVGVNGTPIGQSANNATSISLNFNQNGEASFPISYREVGSLALHARFTGSGDEQ
DLLLEGQDSFIRVPRALVLSANNPYNPTHPNGQCSAENISCNVFARADENFDLIIRAVVA
APIEDNDFTNNLTAYNYQQQNIALQHTLVQPSAGQSGVLGVNEYTHLLGGTTTIAQKVSE
VGVFDFSLFAPTHYLGLDLASANLPIAVTSTGSIGRFIPAYFSVSPMSNVTLDAACKTGN
AFSYLGQPFEYSNSPGLYLQPKSANNADTQNYLIDPWWRYNNQWNGRTYSDSANGVNLGF
DNLQTSPISRQALNNSGIVLNGERVWYQKPLQPKPVFNSAFDLTLNASNLTDQDGVCYRQ
NASSPCLGYTFSHIDGAMPLYWGKLVIQDVYGPETQASEQPIYVEHFTNNGFVRTIEDSC
TALPAITGFTLQSDPNNNGYTVLTTGVAVPPQVLAEHSAANLNSGQRAIRFSAPGAGALG
VIDSVLDLNAHNLLWLAEDKDGDNNFDQTTQGRAQFGLYRGSDRVIWWRESN
Download sequence
Identical sequences A0A0H3AG81 A0A0H6B525 A0A0K9UPU0 A0A0X1L2H6 C3LRE5 Q9KUV0
gi|147673465|ref|YP_001218683.1| gi|360037052|ref|YP_004938815.1| NP_230068.1.72393 WP_001045819.1.100388 WP_001045819.1.100440 WP_001045819.1.10071 WP_001045819.1.100976 WP_001045819.1.101117 WP_001045819.1.10121 WP_001045819.1.101220 WP_001045819.1.101314 WP_001045819.1.101507 WP_001045819.1.101933 WP_001045819.1.102054 WP_001045819.1.10626 WP_001045819.1.10834 WP_001045819.1.10887 WP_001045819.1.11270 WP_001045819.1.11879 WP_001045819.1.11885 WP_001045819.1.11965 WP_001045819.1.12252 WP_001045819.1.12262 WP_001045819.1.12332 WP_001045819.1.12525 WP_001045819.1.12527 WP_001045819.1.12548 WP_001045819.1.12590 WP_001045819.1.12686 WP_001045819.1.13053 WP_001045819.1.13155 WP_001045819.1.13156 WP_001045819.1.13454 WP_001045819.1.13652 WP_001045819.1.13725 WP_001045819.1.14080 WP_001045819.1.14179 WP_001045819.1.14257 WP_001045819.1.14263 WP_001045819.1.14904 WP_001045819.1.14995 WP_001045819.1.15109 WP_001045819.1.15134 WP_001045819.1.15179 WP_001045819.1.15200 WP_001045819.1.15516 WP_001045819.1.15786 WP_001045819.1.16351 WP_001045819.1.16382 WP_001045819.1.17232 WP_001045819.1.17295 WP_001045819.1.17621 WP_001045819.1.17738 WP_001045819.1.18375 WP_001045819.1.18392 WP_001045819.1.18447 WP_001045819.1.18577 WP_001045819.1.18862 WP_001045819.1.18916 WP_001045819.1.19126 WP_001045819.1.19128 WP_001045819.1.19442 WP_001045819.1.19503 WP_001045819.1.19597 WP_001045819.1.20065 WP_001045819.1.20107 WP_001045819.1.20379 WP_001045819.1.20404 WP_001045819.1.20669 WP_001045819.1.20699 WP_001045819.1.20758 WP_001045819.1.21073 WP_001045819.1.21281 WP_001045819.1.21558 WP_001045819.1.21671 WP_001045819.1.21717 WP_001045819.1.21764 WP_001045819.1.21815 WP_001045819.1.21866 WP_001045819.1.22521 WP_001045819.1.22773 WP_001045819.1.229 WP_001045819.1.2304 WP_001045819.1.2316 WP_001045819.1.23333 WP_001045819.1.2341 WP_001045819.1.23416 WP_001045819.1.23424 WP_001045819.1.23538 WP_001045819.1.2354 WP_001045819.1.23808 WP_001045819.1.23955 WP_001045819.1.240 WP_001045819.1.2401 WP_001045819.1.24106 WP_001045819.1.24280 WP_001045819.1.24345 WP_001045819.1.24399 WP_001045819.1.24980 WP_001045819.1.25649 WP_001045819.1.26020 WP_001045819.1.26156 WP_001045819.1.26223 WP_001045819.1.2627 WP_001045819.1.26326 WP_001045819.1.26508 WP_001045819.1.26580 WP_001045819.1.27186 WP_001045819.1.27435 WP_001045819.1.27458 WP_001045819.1.27639 WP_001045819.1.27863 WP_001045819.1.28431 WP_001045819.1.2849 WP_001045819.1.28508 WP_001045819.1.29095 WP_001045819.1.29535 WP_001045819.1.29889 WP_001045819.1.30107 WP_001045819.1.3032 WP_001045819.1.30360 WP_001045819.1.3054 WP_001045819.1.30927 WP_001045819.1.31096 WP_001045819.1.31718 WP_001045819.1.32264 WP_001045819.1.32271 WP_001045819.1.32814 WP_001045819.1.32955 WP_001045819.1.33093 WP_001045819.1.33625 WP_001045819.1.33811 WP_001045819.1.33819 WP_001045819.1.34108 WP_001045819.1.34195 WP_001045819.1.34261 WP_001045819.1.34634 WP_001045819.1.3514 WP_001045819.1.35201 WP_001045819.1.35266 WP_001045819.1.35630 WP_001045819.1.35881 WP_001045819.1.3635 WP_001045819.1.36513 WP_001045819.1.36668 WP_001045819.1.36686 WP_001045819.1.36874 WP_001045819.1.36973 WP_001045819.1.37054 WP_001045819.1.37260 WP_001045819.1.37262 WP_001045819.1.37537 WP_001045819.1.37676 WP_001045819.1.37999 WP_001045819.1.38420 WP_001045819.1.38590 WP_001045819.1.39514 WP_001045819.1.39675 WP_001045819.1.39853 WP_001045819.1.39933 WP_001045819.1.40039 WP_001045819.1.40152 WP_001045819.1.40433 WP_001045819.1.40459 WP_001045819.1.40470 WP_001045819.1.40484 WP_001045819.1.40491 WP_001045819.1.40542 WP_001045819.1.40571 WP_001045819.1.40782 WP_001045819.1.41573 WP_001045819.1.4175 WP_001045819.1.42128 WP_001045819.1.42152 WP_001045819.1.42498 WP_001045819.1.42617 WP_001045819.1.4272 WP_001045819.1.42783 WP_001045819.1.4284 WP_001045819.1.42853 WP_001045819.1.42865 WP_001045819.1.42885 WP_001045819.1.43335 WP_001045819.1.4365 WP_001045819.1.43884 WP_001045819.1.439 WP_001045819.1.44569 WP_001045819.1.44730 WP_001045819.1.45055 WP_001045819.1.45127 WP_001045819.1.45155 WP_001045819.1.45206 WP_001045819.1.45264 WP_001045819.1.45372 WP_001045819.1.45704 WP_001045819.1.45842 WP_001045819.1.45903 WP_001045819.1.45958 WP_001045819.1.46118 WP_001045819.1.46146 WP_001045819.1.46540 WP_001045819.1.4661 WP_001045819.1.47202 WP_001045819.1.4730 WP_001045819.1.4731 WP_001045819.1.47417 WP_001045819.1.47428 WP_001045819.1.47794 WP_001045819.1.47796 WP_001045819.1.47846 WP_001045819.1.47942 WP_001045819.1.48128 WP_001045819.1.48715 WP_001045819.1.488 WP_001045819.1.48927 WP_001045819.1.49238 WP_001045819.1.49317 WP_001045819.1.50277 WP_001045819.1.50577 WP_001045819.1.50625 WP_001045819.1.50813 WP_001045819.1.50822 WP_001045819.1.50980 WP_001045819.1.51160 WP_001045819.1.51177 WP_001045819.1.51661 WP_001045819.1.5201 WP_001045819.1.52391 WP_001045819.1.52676 WP_001045819.1.53085 WP_001045819.1.5320 WP_001045819.1.53214 WP_001045819.1.5397 WP_001045819.1.54191 WP_001045819.1.5425 WP_001045819.1.54398 WP_001045819.1.5450 WP_001045819.1.54706 WP_001045819.1.54901 WP_001045819.1.55092 WP_001045819.1.55665 WP_001045819.1.55929 WP_001045819.1.55932 WP_001045819.1.56429 WP_001045819.1.56785 WP_001045819.1.56807 WP_001045819.1.57148 WP_001045819.1.57300 WP_001045819.1.57518 WP_001045819.1.57546 WP_001045819.1.57678 WP_001045819.1.57945 WP_001045819.1.58295 WP_001045819.1.58596 WP_001045819.1.58844 WP_001045819.1.58975 WP_001045819.1.59010 WP_001045819.1.59194 WP_001045819.1.59378 WP_001045819.1.59394 WP_001045819.1.5943 WP_001045819.1.59554 WP_001045819.1.59633 WP_001045819.1.59741 WP_001045819.1.59916 WP_001045819.1.60386 WP_001045819.1.60633 WP_001045819.1.60955 WP_001045819.1.61169 WP_001045819.1.61523 WP_001045819.1.61644 WP_001045819.1.61753 WP_001045819.1.61869 WP_001045819.1.61875 WP_001045819.1.61935 WP_001045819.1.62165 WP_001045819.1.62324 WP_001045819.1.62425 WP_001045819.1.63347 WP_001045819.1.63546 WP_001045819.1.6366 WP_001045819.1.63723 WP_001045819.1.63749 WP_001045819.1.63779 WP_001045819.1.63911 WP_001045819.1.64201 WP_001045819.1.64253 WP_001045819.1.64315 WP_001045819.1.64382 WP_001045819.1.64441 WP_001045819.1.65007 WP_001045819.1.65051 WP_001045819.1.65086 WP_001045819.1.65528 WP_001045819.1.66329 WP_001045819.1.66633 WP_001045819.1.66696 WP_001045819.1.67616 WP_001045819.1.68424 WP_001045819.1.68506 WP_001045819.1.68723 WP_001045819.1.68925 WP_001045819.1.69049 WP_001045819.1.69843 WP_001045819.1.69857 WP_001045819.1.70069 WP_001045819.1.70176 WP_001045819.1.70247 WP_001045819.1.7049 WP_001045819.1.70775 WP_001045819.1.70813 WP_001045819.1.70892 WP_001045819.1.71129 WP_001045819.1.72106 WP_001045819.1.72241 WP_001045819.1.72326 WP_001045819.1.72361 WP_001045819.1.72369 WP_001045819.1.7238 WP_001045819.1.72480 WP_001045819.1.72856 WP_001045819.1.73148 WP_001045819.1.73429 WP_001045819.1.73555 WP_001045819.1.73855 WP_001045819.1.73929 WP_001045819.1.74111 WP_001045819.1.74503 WP_001045819.1.74666 WP_001045819.1.74991 WP_001045819.1.75012 WP_001045819.1.75326 WP_001045819.1.75378 WP_001045819.1.75778 WP_001045819.1.76425 WP_001045819.1.76486 WP_001045819.1.7654 WP_001045819.1.76645 WP_001045819.1.77029 WP_001045819.1.7717 WP_001045819.1.77355 WP_001045819.1.77397 WP_001045819.1.77445 WP_001045819.1.77703 WP_001045819.1.77794 WP_001045819.1.77830 WP_001045819.1.77914 WP_001045819.1.78157 WP_001045819.1.78428 WP_001045819.1.78531 WP_001045819.1.79776 WP_001045819.1.79943 WP_001045819.1.80024 WP_001045819.1.8023 WP_001045819.1.80339 WP_001045819.1.80500 WP_001045819.1.80618 WP_001045819.1.80628 WP_001045819.1.80702 WP_001045819.1.80744 WP_001045819.1.80808 WP_001045819.1.8117 WP_001045819.1.81871 WP_001045819.1.81917 WP_001045819.1.82119 WP_001045819.1.82248 WP_001045819.1.82262 WP_001045819.1.82413 WP_001045819.1.82583 WP_001045819.1.83040 WP_001045819.1.83073 WP_001045819.1.83082 WP_001045819.1.83109 WP_001045819.1.83703 WP_001045819.1.83761 WP_001045819.1.84385 WP_001045819.1.84519 WP_001045819.1.84610 WP_001045819.1.8480 WP_001045819.1.85007 WP_001045819.1.85086 WP_001045819.1.85498 WP_001045819.1.85822 WP_001045819.1.85878 WP_001045819.1.85961 WP_001045819.1.85972 WP_001045819.1.85998 WP_001045819.1.86057 WP_001045819.1.86192 WP_001045819.1.86269 WP_001045819.1.86879 WP_001045819.1.87286 WP_001045819.1.87355 WP_001045819.1.87573 WP_001045819.1.87602 WP_001045819.1.87804 WP_001045819.1.88057 WP_001045819.1.88230 WP_001045819.1.88283 WP_001045819.1.88350 WP_001045819.1.88556 WP_001045819.1.8867 WP_001045819.1.89144 WP_001045819.1.89441 WP_001045819.1.89719 WP_001045819.1.89822 WP_001045819.1.89889 WP_001045819.1.8997 WP_001045819.1.89995 WP_001045819.1.90133 WP_001045819.1.90227 WP_001045819.1.90437 WP_001045819.1.90675 WP_001045819.1.90774 WP_001045819.1.90889 WP_001045819.1.91262 WP_001045819.1.91274 WP_001045819.1.91539 WP_001045819.1.91747 WP_001045819.1.91794 WP_001045819.1.91841 WP_001045819.1.92038 WP_001045819.1.92063 WP_001045819.1.92069 WP_001045819.1.92157 WP_001045819.1.92401 WP_001045819.1.92516 WP_001045819.1.92696 WP_001045819.1.92703 WP_001045819.1.92952 WP_001045819.1.92993 WP_001045819.1.9302 WP_001045819.1.93060 WP_001045819.1.93399 WP_001045819.1.93836 WP_001045819.1.93945 WP_001045819.1.94426 WP_001045819.1.94441 WP_001045819.1.94481 WP_001045819.1.95549 WP_001045819.1.9561 WP_001045819.1.95662 WP_001045819.1.95733 WP_001045819.1.96001 WP_001045819.1.9607 WP_001045819.1.96089 WP_001045819.1.96187 WP_001045819.1.96311 WP_001045819.1.96471 WP_001045819.1.9660 WP_001045819.1.96687 WP_001045819.1.96693 WP_001045819.1.96704 WP_001045819.1.96980 WP_001045819.1.97100 WP_001045819.1.97144 WP_001045819.1.97516 WP_001045819.1.97552 WP_001045819.1.97650 WP_001045819.1.97799 WP_001045819.1.97832 WP_001045819.1.9787 WP_001045819.1.98021 WP_001045819.1.98116 WP_001045819.1.98172 WP_001045819.1.98246 WP_001045819.1.98280 WP_001045819.1.98624 WP_001045819.1.98642 WP_001045819.1.99128 WP_001045819.1.99204 WP_001045819.1.99417 WP_001045819.1.99452 WP_001045819.1.995 WP_001045819.1.99872 WP_001045819.1.99992 243277.VC0414 345073.VC0395_A2833 579112.VCM66_0399 gi|147673465|ref|YP_001218683.1| NYSGRC-SEC-227008513 gi|15640441|ref|NP_230068.1| gi|227080625|ref|YP_002809176.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]