SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243277.VC0699 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  243277.VC0699
Domain Number - Region: 6-31
Classification Level Classification E-value
Superfamily POZ domain 0.0114
Family Tetramerization domain of potassium channels 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243277.VC0699
Sequence length 31
Comment (Vibrio cholerae)
Sequence
MLMMNKSINMQRFYFIVRDSGKFNKMLHYLR
Download sequence
Identical sequences C3LSV4 Q9KU30
gi|227080880|ref|YP_002809431.1| gi|360034609|ref|YP_004936372.1| 243277.VC0699 579112.VCM66_0657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]