SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243277.VC0961 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243277.VC0961
Domain Number 1 Region: 119-320
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.27e-40
Family Nitrogenase iron protein-like 0.081
Further Details:      
 
Domain Number 2 Region: 17-75
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000547
Family Eukaryotic type KH-domain (KH-domain type I) 0.0083
Further Details:      
 
Weak hits

Sequence:  243277.VC0961
Domain Number - Region: 317-353
Classification Level Classification E-value
Superfamily HMG-box 0.0266
Family HMG-box 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243277.VC0961
Sequence length 367
Comment (Vibrio cholerae)
Sequence
MSNKIITLEINLEPSDNHRLASLCGPFDDNIKHLERRLGVEINYRGNFFTIVGQPHTAAA
ALDIIKTLYVETAPVRGQITDIEPEQIHLAIKESGVLEQHSESSIAHGKEVFVKTKKGVI
KPRTPNQAQYLMNMVTHDITFGVGPAGTGKTYLAVAAAVDALERQEIRRILLTRPAVEAG
EKLGFLPGDLSQKVDPYLRPLYDALFEMLGFERVEKLIERNVIEVAPLAYMRGRTLNDAF
IILDESQNTTVEQMKMFLTRIGFNSRAVITGDVTQIDLPRGAKSGLRHAIEVLNEVDEIS
FNFFQADDVVRHPVVARIVNAYEKWEAQDQKERKEYEQRRREERENKLLEMQRAEMTLSH
NNESNPS
Download sequence
Identical sequences A0A086SRX8 A0A0H3Q4X8 A0A0K9UUA9 A0A0Q0M2Z8 A0A0X1KVB7 A0A220TJF6 A0A2J9UF18 C2HW78 C3LTK9 D7HFD2 Q9KTE1
APC85372 gi|227081135|ref|YP_002809686.1| NP_230608.1.72393 WP_000066204.1.100264 WP_000066204.1.100388 WP_000066204.1.100440 WP_000066204.1.100659 WP_000066204.1.10071 WP_000066204.1.100924 WP_000066204.1.100976 WP_000066204.1.101117 WP_000066204.1.10121 WP_000066204.1.101220 WP_000066204.1.101314 WP_000066204.1.101507 WP_000066204.1.101933 WP_000066204.1.102054 WP_000066204.1.10453 WP_000066204.1.10626 WP_000066204.1.10834 WP_000066204.1.10887 WP_000066204.1.11270 WP_000066204.1.11351 WP_000066204.1.11879 WP_000066204.1.11885 WP_000066204.1.11965 WP_000066204.1.11987 WP_000066204.1.12252 WP_000066204.1.12262 WP_000066204.1.12332 WP_000066204.1.12486 WP_000066204.1.12525 WP_000066204.1.12527 WP_000066204.1.12548 WP_000066204.1.12590 WP_000066204.1.12686 WP_000066204.1.12828 WP_000066204.1.12902 WP_000066204.1.13053 WP_000066204.1.13155 WP_000066204.1.13156 WP_000066204.1.13395 WP_000066204.1.13454 WP_000066204.1.13652 WP_000066204.1.13725 WP_000066204.1.14080 WP_000066204.1.14257 WP_000066204.1.14263 WP_000066204.1.14904 WP_000066204.1.14995 WP_000066204.1.15109 WP_000066204.1.15179 WP_000066204.1.15200 WP_000066204.1.15516 WP_000066204.1.15786 WP_000066204.1.15919 WP_000066204.1.15997 WP_000066204.1.16057 WP_000066204.1.16351 WP_000066204.1.16382 WP_000066204.1.17001 WP_000066204.1.17232 WP_000066204.1.17295 WP_000066204.1.17621 WP_000066204.1.18375 WP_000066204.1.18392 WP_000066204.1.18447 WP_000066204.1.18577 WP_000066204.1.18845 WP_000066204.1.18862 WP_000066204.1.18916 WP_000066204.1.19126 WP_000066204.1.19128 WP_000066204.1.19442 WP_000066204.1.19503 WP_000066204.1.19597 WP_000066204.1.19924 WP_000066204.1.20065 WP_000066204.1.20107 WP_000066204.1.20336 WP_000066204.1.20379 WP_000066204.1.20404 WP_000066204.1.20595 WP_000066204.1.20602 WP_000066204.1.20669 WP_000066204.1.20699 WP_000066204.1.20758 WP_000066204.1.21073 WP_000066204.1.21279 WP_000066204.1.21281 WP_000066204.1.21558 WP_000066204.1.21717 WP_000066204.1.21764 WP_000066204.1.21815 WP_000066204.1.21866 WP_000066204.1.22521 WP_000066204.1.22770 WP_000066204.1.22773 WP_000066204.1.229 WP_000066204.1.22953 WP_000066204.1.2304 WP_000066204.1.23312 WP_000066204.1.23333 WP_000066204.1.23361 WP_000066204.1.2341 WP_000066204.1.23416 WP_000066204.1.23424 WP_000066204.1.23532 WP_000066204.1.23538 WP_000066204.1.2354 WP_000066204.1.23637 WP_000066204.1.23751 WP_000066204.1.23761 WP_000066204.1.23808 WP_000066204.1.23955 WP_000066204.1.240 WP_000066204.1.2401 WP_000066204.1.24106 WP_000066204.1.24280 WP_000066204.1.24345 WP_000066204.1.24399 WP_000066204.1.24952 WP_000066204.1.24980 WP_000066204.1.25073 WP_000066204.1.25386 WP_000066204.1.26020 WP_000066204.1.26156 WP_000066204.1.2627 WP_000066204.1.26326 WP_000066204.1.26508 WP_000066204.1.26580 WP_000066204.1.26813 WP_000066204.1.27186 WP_000066204.1.27435 WP_000066204.1.27458 WP_000066204.1.27532 WP_000066204.1.27639 WP_000066204.1.27863 WP_000066204.1.28431 WP_000066204.1.2849 WP_000066204.1.29095 WP_000066204.1.29535 WP_000066204.1.29708 WP_000066204.1.29889 WP_000066204.1.30045 WP_000066204.1.30107 WP_000066204.1.30292 WP_000066204.1.3032 WP_000066204.1.30360 WP_000066204.1.3054 WP_000066204.1.30927 WP_000066204.1.31096 WP_000066204.1.31396 WP_000066204.1.31718 WP_000066204.1.31853 WP_000066204.1.31964 WP_000066204.1.32111 WP_000066204.1.32264 WP_000066204.1.32271 WP_000066204.1.32395 WP_000066204.1.32814 WP_000066204.1.32942 WP_000066204.1.32955 WP_000066204.1.33093 WP_000066204.1.33625 WP_000066204.1.33811 WP_000066204.1.33819 WP_000066204.1.34108 WP_000066204.1.34195 WP_000066204.1.34634 WP_000066204.1.34663 WP_000066204.1.3514 WP_000066204.1.35201 WP_000066204.1.35266 WP_000066204.1.35630 WP_000066204.1.35880 WP_000066204.1.35881 WP_000066204.1.3635 WP_000066204.1.36354 WP_000066204.1.36364 WP_000066204.1.36384 WP_000066204.1.36441 WP_000066204.1.36513 WP_000066204.1.36668 WP_000066204.1.36686 WP_000066204.1.36874 WP_000066204.1.36956 WP_000066204.1.36973 WP_000066204.1.37054 WP_000066204.1.37260 WP_000066204.1.37262 WP_000066204.1.37537 WP_000066204.1.37676 WP_000066204.1.37784 WP_000066204.1.37999 WP_000066204.1.38420 WP_000066204.1.38590 WP_000066204.1.39208 WP_000066204.1.39460 WP_000066204.1.39514 WP_000066204.1.39675 WP_000066204.1.39853 WP_000066204.1.39933 WP_000066204.1.40039 WP_000066204.1.40152 WP_000066204.1.40346 WP_000066204.1.40433 WP_000066204.1.40459 WP_000066204.1.40470 WP_000066204.1.40484 WP_000066204.1.40491 WP_000066204.1.40542 WP_000066204.1.40740 WP_000066204.1.41538 WP_000066204.1.41569 WP_000066204.1.41573 WP_000066204.1.4175 WP_000066204.1.41883 WP_000066204.1.42128 WP_000066204.1.42152 WP_000066204.1.42441 WP_000066204.1.42498 WP_000066204.1.42617 WP_000066204.1.4272 WP_000066204.1.4284 WP_000066204.1.42853 WP_000066204.1.42865 WP_000066204.1.42885 WP_000066204.1.43103 WP_000066204.1.43222 WP_000066204.1.43335 WP_000066204.1.43407 WP_000066204.1.43428 WP_000066204.1.4365 WP_000066204.1.43884 WP_000066204.1.439 WP_000066204.1.44136 WP_000066204.1.44569 WP_000066204.1.44709 WP_000066204.1.44730 WP_000066204.1.45055 WP_000066204.1.45127 WP_000066204.1.45155 WP_000066204.1.45206 WP_000066204.1.45264 WP_000066204.1.45372 WP_000066204.1.45704 WP_000066204.1.45842 WP_000066204.1.45903 WP_000066204.1.45958 WP_000066204.1.46118 WP_000066204.1.46146 WP_000066204.1.4661 WP_000066204.1.47202 WP_000066204.1.4730 WP_000066204.1.4731 WP_000066204.1.47417 WP_000066204.1.47428 WP_000066204.1.47796 WP_000066204.1.47846 WP_000066204.1.47942 WP_000066204.1.48128 WP_000066204.1.48289 WP_000066204.1.48659 WP_000066204.1.48715 WP_000066204.1.48742 WP_000066204.1.488 WP_000066204.1.48874 WP_000066204.1.48927 WP_000066204.1.49238 WP_000066204.1.49317 WP_000066204.1.50277 WP_000066204.1.5028 WP_000066204.1.50577 WP_000066204.1.50625 WP_000066204.1.50813 WP_000066204.1.50822 WP_000066204.1.50899 WP_000066204.1.50980 WP_000066204.1.51160 WP_000066204.1.51177 WP_000066204.1.5201 WP_000066204.1.52391 WP_000066204.1.5320 WP_000066204.1.53214 WP_000066204.1.5397 WP_000066204.1.54191 WP_000066204.1.5425 WP_000066204.1.54398 WP_000066204.1.5450 WP_000066204.1.54706 WP_000066204.1.54831 WP_000066204.1.54901 WP_000066204.1.55092 WP_000066204.1.55208 WP_000066204.1.55665 WP_000066204.1.55832 WP_000066204.1.55929 WP_000066204.1.55932 WP_000066204.1.56429 WP_000066204.1.56785 WP_000066204.1.56807 WP_000066204.1.57148 WP_000066204.1.57300 WP_000066204.1.57518 WP_000066204.1.57546 WP_000066204.1.57678 WP_000066204.1.57945 WP_000066204.1.58295 WP_000066204.1.58596 WP_000066204.1.58844 WP_000066204.1.58975 WP_000066204.1.59010 WP_000066204.1.59194 WP_000066204.1.59378 WP_000066204.1.59394 WP_000066204.1.5943 WP_000066204.1.59554 WP_000066204.1.59633 WP_000066204.1.59741 WP_000066204.1.59916 WP_000066204.1.60386 WP_000066204.1.60633 WP_000066204.1.60694 WP_000066204.1.60955 WP_000066204.1.61169 WP_000066204.1.61523 WP_000066204.1.61644 WP_000066204.1.61753 WP_000066204.1.61869 WP_000066204.1.61875 WP_000066204.1.61935 WP_000066204.1.62165 WP_000066204.1.62324 WP_000066204.1.62425 WP_000066204.1.62763 WP_000066204.1.63347 WP_000066204.1.63546 WP_000066204.1.63655 WP_000066204.1.6366 WP_000066204.1.63723 WP_000066204.1.63749 WP_000066204.1.63779 WP_000066204.1.63911 WP_000066204.1.64033 WP_000066204.1.64201 WP_000066204.1.64253 WP_000066204.1.64315 WP_000066204.1.64382 WP_000066204.1.64441 WP_000066204.1.6455 WP_000066204.1.64943 WP_000066204.1.65007 WP_000066204.1.65051 WP_000066204.1.65086 WP_000066204.1.66329 WP_000066204.1.66459 WP_000066204.1.66633 WP_000066204.1.66696 WP_000066204.1.67616 WP_000066204.1.67839 WP_000066204.1.68424 WP_000066204.1.68506 WP_000066204.1.68723 WP_000066204.1.68925 WP_000066204.1.69049 WP_000066204.1.69530 WP_000066204.1.69843 WP_000066204.1.69857 WP_000066204.1.69943 WP_000066204.1.70069 WP_000066204.1.70176 WP_000066204.1.70222 WP_000066204.1.70247 WP_000066204.1.7049 WP_000066204.1.70813 WP_000066204.1.70892 WP_000066204.1.71129 WP_000066204.1.71300 WP_000066204.1.72106 WP_000066204.1.72241 WP_000066204.1.72326 WP_000066204.1.72328 WP_000066204.1.72361 WP_000066204.1.72369 WP_000066204.1.7238 WP_000066204.1.72480 WP_000066204.1.72856 WP_000066204.1.72964 WP_000066204.1.73148 WP_000066204.1.73297 WP_000066204.1.73429 WP_000066204.1.73555 WP_000066204.1.73855 WP_000066204.1.73929 WP_000066204.1.74111 WP_000066204.1.74503 WP_000066204.1.74666 WP_000066204.1.74991 WP_000066204.1.75012 WP_000066204.1.75326 WP_000066204.1.75378 WP_000066204.1.75778 WP_000066204.1.76271 WP_000066204.1.76425 WP_000066204.1.76486 WP_000066204.1.7654 WP_000066204.1.76645 WP_000066204.1.77029 WP_000066204.1.7717 WP_000066204.1.77355 WP_000066204.1.77397 WP_000066204.1.77445 WP_000066204.1.77703 WP_000066204.1.77794 WP_000066204.1.77830 WP_000066204.1.77914 WP_000066204.1.78157 WP_000066204.1.78172 WP_000066204.1.78531 WP_000066204.1.79044 WP_000066204.1.79776 WP_000066204.1.79943 WP_000066204.1.80024 WP_000066204.1.8023 WP_000066204.1.80339 WP_000066204.1.80500 WP_000066204.1.80618 WP_000066204.1.80628 WP_000066204.1.80702 WP_000066204.1.80744 WP_000066204.1.80808 WP_000066204.1.80909 WP_000066204.1.8117 WP_000066204.1.81563 WP_000066204.1.81871 WP_000066204.1.81872 WP_000066204.1.81917 WP_000066204.1.82119 WP_000066204.1.82193 WP_000066204.1.82248 WP_000066204.1.82262 WP_000066204.1.82413 WP_000066204.1.82583 WP_000066204.1.83040 WP_000066204.1.83073 WP_000066204.1.83082 WP_000066204.1.83109 WP_000066204.1.83703 WP_000066204.1.83761 WP_000066204.1.84385 WP_000066204.1.84519 WP_000066204.1.84610 WP_000066204.1.8480 WP_000066204.1.85007 WP_000066204.1.85086 WP_000066204.1.85498 WP_000066204.1.85822 WP_000066204.1.85878 WP_000066204.1.85961 WP_000066204.1.85972 WP_000066204.1.85998 WP_000066204.1.86057 WP_000066204.1.86192 WP_000066204.1.86874 WP_000066204.1.86879 WP_000066204.1.87274 WP_000066204.1.87286 WP_000066204.1.87335 WP_000066204.1.87355 WP_000066204.1.87602 WP_000066204.1.87804 WP_000066204.1.88057 WP_000066204.1.88230 WP_000066204.1.88283 WP_000066204.1.88350 WP_000066204.1.88556 WP_000066204.1.8867 WP_000066204.1.89144 WP_000066204.1.89441 WP_000066204.1.89447 WP_000066204.1.89822 WP_000066204.1.89889 WP_000066204.1.8997 WP_000066204.1.89995 WP_000066204.1.90133 WP_000066204.1.90227 WP_000066204.1.9040 WP_000066204.1.90437 WP_000066204.1.90675 WP_000066204.1.90774 WP_000066204.1.90889 WP_000066204.1.91247 WP_000066204.1.91262 WP_000066204.1.91274 WP_000066204.1.91539 WP_000066204.1.91747 WP_000066204.1.91794 WP_000066204.1.91841 WP_000066204.1.92022 WP_000066204.1.92038 WP_000066204.1.92063 WP_000066204.1.92069 WP_000066204.1.92157 WP_000066204.1.92322 WP_000066204.1.92401 WP_000066204.1.92412 WP_000066204.1.92516 WP_000066204.1.92559 WP_000066204.1.92696 WP_000066204.1.92703 WP_000066204.1.92952 WP_000066204.1.92993 WP_000066204.1.9302 WP_000066204.1.93060 WP_000066204.1.93399 WP_000066204.1.93441 WP_000066204.1.93836 WP_000066204.1.93945 WP_000066204.1.94426 WP_000066204.1.94441 WP_000066204.1.94481 WP_000066204.1.94774 WP_000066204.1.94827 WP_000066204.1.94887 WP_000066204.1.95204 WP_000066204.1.95516 WP_000066204.1.95549 WP_000066204.1.9561 WP_000066204.1.95662 WP_000066204.1.95733 WP_000066204.1.95818 WP_000066204.1.95976 WP_000066204.1.9607 WP_000066204.1.96089 WP_000066204.1.96187 WP_000066204.1.96311 WP_000066204.1.96471 WP_000066204.1.9660 WP_000066204.1.96687 WP_000066204.1.96704 WP_000066204.1.96980 WP_000066204.1.97100 WP_000066204.1.97144 WP_000066204.1.97516 WP_000066204.1.97552 WP_000066204.1.97562 WP_000066204.1.97650 WP_000066204.1.97799 WP_000066204.1.97832 WP_000066204.1.9787 WP_000066204.1.98021 WP_000066204.1.98116 WP_000066204.1.98172 WP_000066204.1.98246 WP_000066204.1.98280 WP_000066204.1.98373 WP_000066204.1.98619 WP_000066204.1.98624 WP_000066204.1.98642 WP_000066204.1.99128 WP_000066204.1.99204 WP_000066204.1.9939 WP_000066204.1.99417 WP_000066204.1.99452 WP_000066204.1.995 WP_000066204.1.99861 WP_000066204.1.99872 WP_000066204.1.99949 WP_000066204.1.99992 gi|229608458|ref|YP_002879106.1| gi|379740792|ref|YP_005332761.1| gi|360034865|ref|YP_004936628.1| gi|15640977|ref|NP_230608.1| 243277.VC0961 579112.VCM66_0917 593588.VCD_003376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]