SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243277.VC1784 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243277.VC1784
Domain Number 1 Region: 52-241
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.88e-73
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.00000000676
Further Details:      
 
Domain Number 2 Region: 373-568
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.15e-68
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.00000000635
Further Details:      
 
Domain Number 3 Region: 250-382,564-801
Classification Level Classification E-value
Superfamily Sialidases 9.08e-55
Family Sialidases (neuraminidases) 0.0000000000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243277.VC1784
Sequence length 807
Comment (Vibrio cholerae)
Sequence
MSIKMTSQRRRASIHKETDSNIKGVDMRFKNVKKTALMLAMFGMATSSNAALFDYNATGD
TEFDSPAKQGWMQDNTNNGSGVLTNADGMPAWLVQGIGGRAQWTYSLSTNQHAQASSFGW
RMTTEMKVLSGGMITNYYANGTQRVLPIISLDSSGNLVVEFEGQTGRTVLATGTAATEYH
KFELVFLPGSNPSASFYFDGKLIRDNIQPTASKQNMIVWGNGSSNTDGVAAYRDIKFEIQ
GDVIFRGPDRIPSIVASSVTPGVVTAFAEKRVGGGDPGALSNTNDIITRTSRDGGITWDT
ELNLTEQINVSDEFDFSDPRPIYDPSSNTVLVSYARWPTDAAQNGDRIKPWMPNGIFYSV
YDVASGNWQAPIDVTDQVKERSFQIAGWGGSELYRRNTSLNSQQDWQSNAKIRIVDGAAN
QIQVADGSRKYVVTLSIDESGGLVANLNGVSAPIILQSEHAKVHSFHDYELQYSALNHTT
TLFVDGQQITTWAGEVSQENNIQFGNADAQIDGRLHVQKIVLTQQGHNLVEFDAFYLAQQ
TPEVEKDLEKLGWTKIKTGNTMSLYGNASVNPGPGHGITLTRQQNISGSQNGRLIYPAIV
LDRFFLNVMSIYSDDGGSNWQTGSTLPIPFRWKSSSILETLEPSEADMVELQNGDLLLTA
RLDFNQIVNGVNYSPRQQFLSKDGGITWSLLEANNANVFSNISTGTVDASITRFEQSDGS
HFLLFTNPQGNPAGTNGRQNLGLWFSFDEGVTWKGPIQLVNGASAYSDIYQLDSENAIVI
VETDNSNMRILRMPITLLKQKLTLSQN
Download sequence
Identical sequences A0A172PZK6 A0A1V9PTA5 C3LNA3
gi|15641787|ref|NP_231419.1| gi|227081929|ref|YP_002810480.1| gi|147673281|ref|YP_001217324.1| NP_231419.1.72393 WP_001889713.1.100264 WP_001889713.1.100388 WP_001889713.1.100440 WP_001889713.1.10071 WP_001889713.1.100976 WP_001889713.1.101117 WP_001889713.1.10121 WP_001889713.1.101220 WP_001889713.1.101314 WP_001889713.1.101507 WP_001889713.1.101933 WP_001889713.1.102054 WP_001889713.1.1024 WP_001889713.1.10626 WP_001889713.1.10834 WP_001889713.1.10887 WP_001889713.1.11270 WP_001889713.1.11879 WP_001889713.1.11885 WP_001889713.1.11965 WP_001889713.1.12262 WP_001889713.1.12332 WP_001889713.1.12525 WP_001889713.1.12527 WP_001889713.1.12548 WP_001889713.1.12590 WP_001889713.1.12686 WP_001889713.1.13053 WP_001889713.1.13155 WP_001889713.1.13156 WP_001889713.1.13454 WP_001889713.1.13652 WP_001889713.1.13725 WP_001889713.1.14080 WP_001889713.1.14179 WP_001889713.1.14257 WP_001889713.1.14263 WP_001889713.1.14904 WP_001889713.1.14995 WP_001889713.1.15109 WP_001889713.1.15134 WP_001889713.1.15179 WP_001889713.1.15200 WP_001889713.1.15516 WP_001889713.1.15786 WP_001889713.1.15997 WP_001889713.1.16351 WP_001889713.1.16382 WP_001889713.1.17232 WP_001889713.1.17295 WP_001889713.1.17621 WP_001889713.1.17738 WP_001889713.1.18375 WP_001889713.1.18392 WP_001889713.1.18447 WP_001889713.1.18577 WP_001889713.1.18862 WP_001889713.1.19126 WP_001889713.1.19128 WP_001889713.1.19428 WP_001889713.1.19442 WP_001889713.1.19503 WP_001889713.1.19597 WP_001889713.1.20107 WP_001889713.1.20379 WP_001889713.1.20404 WP_001889713.1.20602 WP_001889713.1.20669 WP_001889713.1.20699 WP_001889713.1.20758 WP_001889713.1.21073 WP_001889713.1.21281 WP_001889713.1.21558 WP_001889713.1.21671 WP_001889713.1.21717 WP_001889713.1.21764 WP_001889713.1.21815 WP_001889713.1.21866 WP_001889713.1.22521 WP_001889713.1.22773 WP_001889713.1.229 WP_001889713.1.22953 WP_001889713.1.2304 WP_001889713.1.2316 WP_001889713.1.23333 WP_001889713.1.2341 WP_001889713.1.23416 WP_001889713.1.23424 WP_001889713.1.23538 WP_001889713.1.2354 WP_001889713.1.23808 WP_001889713.1.23955 WP_001889713.1.240 WP_001889713.1.2401 WP_001889713.1.24106 WP_001889713.1.24280 WP_001889713.1.24345 WP_001889713.1.24399 WP_001889713.1.24980 WP_001889713.1.25649 WP_001889713.1.26020 WP_001889713.1.26156 WP_001889713.1.26223 WP_001889713.1.2627 WP_001889713.1.26326 WP_001889713.1.26508 WP_001889713.1.26580 WP_001889713.1.27186 WP_001889713.1.27435 WP_001889713.1.27458 WP_001889713.1.27639 WP_001889713.1.27863 WP_001889713.1.28431 WP_001889713.1.2849 WP_001889713.1.28508 WP_001889713.1.29095 WP_001889713.1.29708 WP_001889713.1.29889 WP_001889713.1.30107 WP_001889713.1.30292 WP_001889713.1.3032 WP_001889713.1.30360 WP_001889713.1.3054 WP_001889713.1.30927 WP_001889713.1.31096 WP_001889713.1.31718 WP_001889713.1.32264 WP_001889713.1.32814 WP_001889713.1.32955 WP_001889713.1.33019 WP_001889713.1.33093 WP_001889713.1.33625 WP_001889713.1.33811 WP_001889713.1.33819 WP_001889713.1.34108 WP_001889713.1.34195 WP_001889713.1.34261 WP_001889713.1.34634 WP_001889713.1.34643 WP_001889713.1.3514 WP_001889713.1.35201 WP_001889713.1.35630 WP_001889713.1.35881 WP_001889713.1.36322 WP_001889713.1.3635 WP_001889713.1.36513 WP_001889713.1.36668 WP_001889713.1.36686 WP_001889713.1.36874 WP_001889713.1.36973 WP_001889713.1.37054 WP_001889713.1.37260 WP_001889713.1.37262 WP_001889713.1.37537 WP_001889713.1.37676 WP_001889713.1.37784 WP_001889713.1.37999 WP_001889713.1.38420 WP_001889713.1.38590 WP_001889713.1.39514 WP_001889713.1.39675 WP_001889713.1.39853 WP_001889713.1.39933 WP_001889713.1.40039 WP_001889713.1.40433 WP_001889713.1.40459 WP_001889713.1.40470 WP_001889713.1.40484 WP_001889713.1.40491 WP_001889713.1.40740 WP_001889713.1.40782 WP_001889713.1.41573 WP_001889713.1.4175 WP_001889713.1.42128 WP_001889713.1.42152 WP_001889713.1.42498 WP_001889713.1.42617 WP_001889713.1.4272 WP_001889713.1.4284 WP_001889713.1.42853 WP_001889713.1.42865 WP_001889713.1.42885 WP_001889713.1.43335 WP_001889713.1.4365 WP_001889713.1.43884 WP_001889713.1.439 WP_001889713.1.44569 WP_001889713.1.44709 WP_001889713.1.44730 WP_001889713.1.45055 WP_001889713.1.45127 WP_001889713.1.45155 WP_001889713.1.45206 WP_001889713.1.45264 WP_001889713.1.45372 WP_001889713.1.45704 WP_001889713.1.45842 WP_001889713.1.45903 WP_001889713.1.45958 WP_001889713.1.46118 WP_001889713.1.46146 WP_001889713.1.46540 WP_001889713.1.4661 WP_001889713.1.47202 WP_001889713.1.4730 WP_001889713.1.4731 WP_001889713.1.47417 WP_001889713.1.47428 WP_001889713.1.47736 WP_001889713.1.47794 WP_001889713.1.47796 WP_001889713.1.47846 WP_001889713.1.47942 WP_001889713.1.48128 WP_001889713.1.48715 WP_001889713.1.488 WP_001889713.1.48927 WP_001889713.1.49238 WP_001889713.1.49317 WP_001889713.1.50277 WP_001889713.1.50577 WP_001889713.1.50813 WP_001889713.1.50822 WP_001889713.1.50980 WP_001889713.1.51160 WP_001889713.1.51177 WP_001889713.1.51661 WP_001889713.1.5201 WP_001889713.1.52391 WP_001889713.1.52676 WP_001889713.1.53085 WP_001889713.1.5320 WP_001889713.1.53214 WP_001889713.1.54191 WP_001889713.1.5425 WP_001889713.1.54398 WP_001889713.1.5450 WP_001889713.1.54706 WP_001889713.1.54901 WP_001889713.1.55092 WP_001889713.1.55665 WP_001889713.1.55929 WP_001889713.1.55932 WP_001889713.1.56429 WP_001889713.1.56785 WP_001889713.1.56807 WP_001889713.1.57148 WP_001889713.1.57300 WP_001889713.1.57518 WP_001889713.1.57678 WP_001889713.1.57945 WP_001889713.1.58295 WP_001889713.1.58596 WP_001889713.1.58844 WP_001889713.1.58975 WP_001889713.1.59010 WP_001889713.1.59194 WP_001889713.1.59378 WP_001889713.1.59394 WP_001889713.1.5943 WP_001889713.1.59554 WP_001889713.1.59633 WP_001889713.1.59741 WP_001889713.1.59916 WP_001889713.1.60386 WP_001889713.1.60633 WP_001889713.1.60694 WP_001889713.1.60955 WP_001889713.1.61169 WP_001889713.1.61523 WP_001889713.1.61644 WP_001889713.1.61753 WP_001889713.1.61869 WP_001889713.1.61875 WP_001889713.1.61935 WP_001889713.1.62165 WP_001889713.1.62324 WP_001889713.1.62425 WP_001889713.1.63347 WP_001889713.1.63546 WP_001889713.1.63655 WP_001889713.1.6366 WP_001889713.1.63723 WP_001889713.1.63749 WP_001889713.1.63779 WP_001889713.1.63911 WP_001889713.1.64201 WP_001889713.1.64253 WP_001889713.1.64315 WP_001889713.1.64382 WP_001889713.1.64441 WP_001889713.1.65051 WP_001889713.1.65086 WP_001889713.1.65528 WP_001889713.1.66329 WP_001889713.1.66633 WP_001889713.1.67616 WP_001889713.1.68424 WP_001889713.1.68506 WP_001889713.1.68723 WP_001889713.1.68925 WP_001889713.1.69049 WP_001889713.1.69843 WP_001889713.1.69857 WP_001889713.1.70069 WP_001889713.1.70176 WP_001889713.1.70247 WP_001889713.1.7049 WP_001889713.1.70775 WP_001889713.1.70892 WP_001889713.1.71129 WP_001889713.1.72106 WP_001889713.1.72241 WP_001889713.1.72326 WP_001889713.1.72361 WP_001889713.1.72369 WP_001889713.1.7238 WP_001889713.1.72480 WP_001889713.1.72856 WP_001889713.1.73148 WP_001889713.1.73429 WP_001889713.1.73555 WP_001889713.1.73855 WP_001889713.1.73929 WP_001889713.1.74111 WP_001889713.1.74503 WP_001889713.1.74666 WP_001889713.1.75012 WP_001889713.1.75326 WP_001889713.1.76425 WP_001889713.1.76486 WP_001889713.1.77029 WP_001889713.1.7717 WP_001889713.1.77355 WP_001889713.1.77445 WP_001889713.1.77703 WP_001889713.1.77794 WP_001889713.1.77830 WP_001889713.1.77914 WP_001889713.1.78157 WP_001889713.1.78428 WP_001889713.1.78531 WP_001889713.1.79044 WP_001889713.1.79776 WP_001889713.1.80024 WP_001889713.1.8023 WP_001889713.1.80339 WP_001889713.1.80500 WP_001889713.1.80618 WP_001889713.1.80628 WP_001889713.1.80702 WP_001889713.1.80744 WP_001889713.1.80808 WP_001889713.1.8117 WP_001889713.1.81871 WP_001889713.1.81917 WP_001889713.1.82119 WP_001889713.1.82193 WP_001889713.1.82248 WP_001889713.1.82262 WP_001889713.1.82413 WP_001889713.1.82583 WP_001889713.1.83040 WP_001889713.1.83073 WP_001889713.1.83082 WP_001889713.1.83109 WP_001889713.1.83703 WP_001889713.1.83761 WP_001889713.1.84385 WP_001889713.1.84519 WP_001889713.1.84610 WP_001889713.1.8480 WP_001889713.1.85007 WP_001889713.1.85498 WP_001889713.1.85822 WP_001889713.1.85961 WP_001889713.1.85972 WP_001889713.1.85998 WP_001889713.1.86057 WP_001889713.1.86192 WP_001889713.1.86874 WP_001889713.1.87335 WP_001889713.1.87355 WP_001889713.1.87573 WP_001889713.1.87602 WP_001889713.1.88230 WP_001889713.1.88283 WP_001889713.1.88350 WP_001889713.1.88556 WP_001889713.1.8867 WP_001889713.1.89144 WP_001889713.1.89441 WP_001889713.1.89447 WP_001889713.1.89719 WP_001889713.1.89889 WP_001889713.1.8997 WP_001889713.1.89995 WP_001889713.1.90133 WP_001889713.1.90227 WP_001889713.1.90437 WP_001889713.1.90675 WP_001889713.1.90774 WP_001889713.1.90889 WP_001889713.1.91247 WP_001889713.1.91539 WP_001889713.1.91747 WP_001889713.1.91794 WP_001889713.1.91841 WP_001889713.1.92038 WP_001889713.1.92063 WP_001889713.1.92157 WP_001889713.1.92401 WP_001889713.1.92516 WP_001889713.1.92559 WP_001889713.1.92696 WP_001889713.1.92703 WP_001889713.1.92952 WP_001889713.1.92993 WP_001889713.1.9302 WP_001889713.1.93399 WP_001889713.1.93836 WP_001889713.1.93945 WP_001889713.1.94426 WP_001889713.1.94441 WP_001889713.1.94481 WP_001889713.1.94887 WP_001889713.1.95516 WP_001889713.1.95549 WP_001889713.1.9561 WP_001889713.1.95662 WP_001889713.1.95733 WP_001889713.1.95976 WP_001889713.1.9607 WP_001889713.1.96089 WP_001889713.1.96187 WP_001889713.1.96311 WP_001889713.1.96471 WP_001889713.1.9660 WP_001889713.1.96687 WP_001889713.1.96693 WP_001889713.1.96704 WP_001889713.1.96980 WP_001889713.1.97100 WP_001889713.1.97144 WP_001889713.1.97516 WP_001889713.1.97552 WP_001889713.1.97650 WP_001889713.1.97799 WP_001889713.1.97832 WP_001889713.1.9787 WP_001889713.1.98021 WP_001889713.1.98116 WP_001889713.1.98172 WP_001889713.1.98280 WP_001889713.1.98642 WP_001889713.1.99128 WP_001889713.1.99204 WP_001889713.1.99417 WP_001889713.1.99452 WP_001889713.1.995 WP_001889713.1.99872 WP_001889713.1.99949 WP_001889713.1.99992 gi|147673281|ref|YP_001217324.1| 243277.VC1784 345073.VC0395_A1381 579112.VCM66_1722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]