SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243365.CV_0434 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243365.CV_0434
Domain Number 1 Region: 299-499
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.36e-50
Family Multidrug efflux transporter AcrB transmembrane domain 0.000000974
Further Details:      
 
Domain Number 2 Region: 831-1027
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.57e-45
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000025
Further Details:      
 
Domain Number 3 Region: 673-721,808-857
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 7.32e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0019
Further Details:      
 
Domain Number 4 Region: 39-132
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.4e-26
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000857
Further Details:      
 
Domain Number 5 Region: 564-671
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 4.92e-25
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0015
Further Details:      
 
Domain Number 6 Region: 138-183,276-332
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.8e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0011
Further Details:      
 
Domain Number 7 Region: 184-273
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.05e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00014
Further Details:      
 
Domain Number 8 Region: 722-807
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 8.5e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243365.CV_0434
Sequence length 1047
Comment (Chromobacterium violaceum)
Sequence
MFSAFFIRRPIFASVISIVIMLAGLAAIKALPIEQYPEIVPPVVNVTASYPGASAEVIAN
TVAAPLEQAINGVDDMLYVQSNSASNGTLSLTVSFKIGTNADQATINVNNRVQSVLSQLP
EEVRRQGVNVRKKSATILQVVSLFSPDNSHDTLFISNYALLNVVDELKRVPGVGDVVNFA
GQDYSMRIWLKPDKLAQLKLTPSDVAAAIREQNSQFAAGKLGAEPTPQKLDFTYTVTTQG
RLSEPEEFENIIVRANPDGSAVKLKDVARVELGALSYDFHGKHNGKATIPIGIFLAPGAN
QLATAQAVETEMLRLSKSFPTGLSYGIPYDTTKFVEVSIEEVYKTLAEAMVLVFLVVFLF
LQNWRATLIPCLAVPVSIVGAFAGMYAFGFTINTLTLFGLVLAIGIVVDDAIVVLENVER
LMTQEGLSPREASLKAMQEVSGALVAIVLVLCSVFIPVAFLGGIAGQMYKQFAMTIAVSV
VISGIVALTLTPALCALILKSEHQHQNRFFEWFNGWFDRLTERYTGGVAFINKRALLAVM
LFGGLLLASAGLFRIIPSSLAPDEDQGYILAAAFLPDGASLQRTAATIDKLDAMMANNPA
VKDRMSFAGFDILSGGNKSNAGVSFITLKPWDERKSPELSSMAVVKDVFAKGAMGVTDGI
ILAFNPPPISGMSNTGGFEAYVQDRAGRTPAELGEITKKMVAAAAKRPELKGVQTTFSAS
VPQVFVKLDRDKAKALGVPVNSVFDTMQSTFGALYVNDFNKFGRTFRVQLQSEAPFRTKV
DDLRNVYVRSQTGQMIPLTALVTIQQTTGPETLERFNVFPAAKLVGGPAPGYSSGQALTA
LEEVAKETLPDGYSLAWTGSAFQEKSTSGSSTLVFGFGMIMVFLILAAQYERWTLPISVL
MAVPFAVFGALMANWLRGLANDVYFQVALVTLIGLSAKNAILIVEFAVQKLEEGMALKEA
ALQAARLRFRPIVMTSLAFVLGCVPLAISSGAGSASRHSIGTGVIGGMLAATFIATFFIP
LFFILIMKLGKQNKPQQNAEAGGNADA
Download sequence
Identical sequences Q7P0Y1
WP_011133989.1.12997 WP_011133989.1.25334 WP_011133989.1.35245 WP_011133989.1.37895 WP_011133989.1.42720 WP_011133989.1.48671 WP_011133989.1.67747 WP_011133989.1.71623 WP_011133989.1.75480 WP_011133989.1.78140 WP_011133989.1.92026 gi|34495889|ref|NP_900104.1| 243365.CV_0434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]