SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243365.CV_1309 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243365.CV_1309
Domain Number 1 Region: 32-202
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 6.56e-42
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000143
Further Details:      
 
Domain Number 2 Region: 217-287
Classification Level Classification E-value
Superfamily PGBD-like 9.42e-21
Family Peptidoglycan binding domain, PGBD 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243365.CV_1309
Sequence length 299
Comment (Chromobacterium violaceum)
Sequence
MASRRQFLRRTGMIVAGGALLAAPAARAQGEMIEYWIDESRSSANQDSRIRTLVFHYTAE
DFATSLKLLTEPQYRTSAHYLVPDAATLSRRPAILRLVEEERRAWHAGDSYWRGQRYLNG
ASIGVEIVNRGYPSPLQDDWPPMRRDWQAFDDAQIAQVGKLAAGIVARHRIQPCDVVGHA
DIAPGRKMDPGPKFPWERLHREFGVGAWPDPDDVRRFLALQPGTPDAASWQRRLAAYGYD
APRSGEWDEKTRHAIQAFQMHFRPARYDGVPDAESSAILDALLDKYLGPVPGGEEGEHP
Download sequence
Identical sequences Q7NYG5
243365.CV_1309 gi|34496764|ref|NP_900979.1| WP_011134863.1.48671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]