SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243365.CV_3115 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243365.CV_3115
Domain Number 1 Region: 69-178,238-344
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.05e-23
Family Legume lectins 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243365.CV_3115
Sequence length 1077
Comment (Chromobacterium violaceum)
Sequence
MTALLAASLWPQAAGAVTVSDNFTGGSAQLNWLVFGGACMTAGNGSGTIPACGSKDPSGN
TQIGGYSGTLPDSNGNGALRLTNSAGSQSGAIVYNSLFPSSSGLQATFTSYTYDGDSGGS
ARNGADGMSFFLLTAIPSAVGSFGGSLGYSCSNVNSPYNGIIGGYLGLGMDEYGNFPNGG
YYNDNTSSGPGAKPQNISLRGAGSVAASSLGTQFGRSFSASMVQSVCRNGNYNGTSVMNY
PFISIPGTSGGVYQLPSSQPMANESATRRGQAVPISYKLKITPANLLSLWYSYNNGAYVP
VITNYDINNTAVSGPLPSQITFGFAASTGASRNVHEISCFQAQPFTQSASSSGLNSQQTT
LIRTGTQQYVASYHADNWWGSLASYALQGNTSTGQVSVASTATWDSSCVLTGGSCATTGA
SNMNAQTSRAILSWSGSQGIPFQWANLTAGQQSAISPDGNGSARVSYLRGARGNEVTTLG
SGLFRDRDSVLGDLINSSPIWVGPPQNNYQATWSDKLYPSASPAENATGAQTYPAYQSAN
ATRTNVVYNGGNDGMLHGFRSGANDANGNYVATNNDGQEVLAYLPAAVQANTVQYSNPTY
PHQYFVDATPVADDLFYNSAWHTWLIGGLGAGGQAIYMLDVSNPANFSETNAASLVVSEI
NSGTLSCVNKATCGNDLGYTFGTPVIARFHNGQWGAVFGNGYNSANGHAVIFIMLVNSSG
APSFYELDTGSGSANDPSGAGGKNGIYYTTVADLDGDNTADYIYAGDLFGNVWRFDVTGS
TPSSWSVSQFGKGAASPLFTTQYTYCSSAQISAGSCTPSLQPITSKLLVTAIPTGNTSPR
VLVSFGTGQKIPFTTNSADVYAGGTQSLYGVWDWDMSGWNTLTGQSAYYSQAAPTGGLTV
RPSNLTAQTVAASYSSTLGSVQGYRALSNNAVCWQGVSSCSSYGWLLNLPGSNEQVIYNP
VSQLGTFTVNTTIPPNSNPSSCTVSSATGFTMSLNPKTGGATLRSYYANDSGNFNGISGS
VIDGIAVNMAGSPSVVRFLGNYFAIGSSISGGPVATPPQINPAAFDLHARLNWIELR
Download sequence
Identical sequences Q7NTE3
243365.CV_3115 gi|34498570|ref|NP_902785.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]