SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243365.CV_3877 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243365.CV_3877
Domain Number 1 Region: 39-141
Classification Level Classification E-value
Superfamily FlaG-like 1.2e-26
Family FlaG-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243365.CV_3877
Sequence length 141
Comment (Chromobacterium violaceum)
Sequence
MQIPSILSPSVPTTSAPVQRQQLVELAQAPTSDQNQQVLAETTQAVAAVGQNQQQQAAAD
SEQKQQSLTKQLEDSVKQLNNTASLYNSSLLFSVDKDTGATVVKVVDKENNKVIRQIPSE
EALRIAKAIGDFKGLLLKDKA
Download sequence
Identical sequences A0A1R0MYQ2 A0A202B4F0 Q7NRA6
gi|34499332|ref|NP_903547.1| WP_011137424.1.12997 WP_011137424.1.25334 WP_011137424.1.35245 WP_011137424.1.37895 WP_011137424.1.42720 WP_011137424.1.47683 WP_011137424.1.48671 WP_011137424.1.50066 WP_011137424.1.67747 WP_011137424.1.71623 WP_011137424.1.75480 WP_011137424.1.78140 WP_011137424.1.78630 WP_011137424.1.92026 243365.CV_3877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]