SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246194.CHY_0425 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246194.CHY_0425
Domain Number 1 Region: 55-286
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.45e-38
Family Extended AAA-ATPase domain 0.067
Further Details:      
 
Domain Number 2 Region: 9-77
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246194.CHY_0425
Sequence length 325
Comment (Carboxydothermus hydrogenoformans Z-2901)
Sequence
MAKKEQRMVVADKEFFRALFGKYDENLKLIEELLPVTINLREGEILIAGEEDAVNKAVGL
VEDLYNYYLAGNPITTREIRYAFSAEKRGVLGLLGDETVYITPRGKKIKPKSLRQKMYLE
AIKKYDIVFAIGPAGTGKTYLAVVMAVLALKQKEVARIILTRPAVEAGEKLGFLPGDLQE
KVNPYLRPLYDSLYDILGLETTQKYLEKQIIEVAPLAYMRGRTLDDAFIILDEAQNTTPE
QMKMFLTRLGFGSKAVITGDTTQVDLPRGQESGLVEAEQILKPIKGINFSYFTREDVVRH
PLVQEIIEQYEKARQIKDREGTGHS
Download sequence
Identical sequences Q3AEZ8
246194.CHY_0425 gi|78044880|ref|YP_359286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]