SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246194.CHY_0595 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246194.CHY_0595
Domain Number 1 Region: 1-220
Classification Level Classification E-value
Superfamily Flavoproteins 8.53e-32
Family Hypothetical protein YwqN 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246194.CHY_0595
Sequence length 223
Comment (Carboxydothermus hydrogenoformans Z-2901)
Sequence
MKVFALMGSPREGSNTDILIEEALKPAREAGWEVEKFNIDQLYINPCRGCMECRGTGDCS
LEEDDILVVARAMAEADAYIIGAPVYGNHLPGQVKVLFDRLSGLIHKVSYDGASLRSQSR
LPHKKRRVFIFAVAAAGRPESCDGVLRYLKFFVRPELNGGEVFELAVTGVGAKGQIGFGP
EELEKMLIKYNYDNPEEKIKEYLDLHQKYLNLAREFGQKILTL
Download sequence
Identical sequences Q3AEI3
246194.CHY_0595 gi|78044261|ref|YP_359451.1| WP_011343527.1.931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]