SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246194.CHY_1168 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246194.CHY_1168
Domain Number 1 Region: 304-465
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.2e-33
Family HD domain 0.019
Further Details:      
 
Domain Number 2 Region: 201-297
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.92e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246194.CHY_1168
Sequence length 513
Comment (Carboxydothermus hydrogenoformans Z-2901)
Sequence
MNLITDIIIAVAGVGVGVAAGYVIRKNIAEAAIGSAEAQAKKIIDEATKAAEAKKREAVL
EAKEEILKMKNEVEREHRERRQELQRLERRLLSKEETLDRKIESFERKEEQLAKKEQEIE
NLRQSLEETLQKELAELERISGLSTEEARELLLKQVEEEVQQEMALLIKEIETKAKEEAE
KRAREIITLAIQRCAADHAAETTVTVVALPNDEMKGRIIGREGRNIRTFESLTGVDLIID
DTPEAVILSGFDPIRREIARRALEKLIQDGRIHPARIEEMVERATKEVEQDIREAGEQAA
FEVNVHGLHPEIIKLLGRLKFRTSYGQNILKHSIEVAHLAGLMAAELGADVALAKRAGLL
HDIGKAVDHEVEGSHVEIGVELAKKYREHPEVLHAIATHHGDEEPKTVEAVLVQAADAIS
AARPGARRETLEAYLKRLEKLEGIANEFEGVEKSYAIQAGRELRILVKPEKIDDLASVRL
AREIAKKIEEEVEYPGQIKVTVIRETRAVDYAK
Download sequence
Identical sequences Q3ACX1
246194.CHY_1168 gi|78042872|ref|YP_360013.1| WP_011344089.1.88130 WP_011344089.1.931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]