SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246194.CHY_1683 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  246194.CHY_1683
Domain Number - Region: 47-125
Classification Level Classification E-value
Superfamily Cullin homology domain 0.0392
Family Cullin homology domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 246194.CHY_1683
Sequence length 143
Comment (Carboxydothermus hydrogenoformans Z-2901)
Sequence
MLERSIYKKIEWYLFNYFNIRREINEYRDEVLNSGRQLIEQGGGGISRHSDPTALKAIKL
ASNAEIEKYEKWIKVIEKVIEHFKGTEKGKLLQMRYFDEYAERYICNKLHIERTTYFTWK
NEIVLYTAMLAIQYGLIKVDRIA
Download sequence
Identical sequences Q3ABI1
gi|78044062|ref|YP_360503.1| WP_011344578.1.931 246194.CHY_1683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]