SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246194.CHY_1758 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246194.CHY_1758
Domain Number 1 Region: 305-498
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.1e-54
Family Ribonuclease PH domain 1-like 0.00000932
Further Details:      
 
Domain Number 2 Region: 6-147
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.99e-51
Family Ribonuclease PH domain 1-like 0.0000115
Further Details:      
 
Domain Number 3 Region: 461-560
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-30
Family Ribonuclease PH domain 2-like 0.0000875
Further Details:      
 
Domain Number 4 Region: 148-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.97e-26
Family Ribonuclease PH domain 2-like 0.0028
Further Details:      
 
Domain Number 5 Region: 566-651
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.03e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 235-337
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 7.72e-21
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0018
Further Details:      
 
Domain Number 7 Region: 631-718
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.44e-17
Family Cold shock DNA-binding domain-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 246194.CHY_1758
Sequence length 731
Comment (Carboxydothermus hydrogenoformans Z-2901)
Sequence
MTTGRQILEKEIMIAGRPLKLTAGKVATQASGSVLVSYGDTVVLVTATGSKEPREGIDFF
PLTVDYEERFYAVGKIPGGFIKREGRPSEKAILSARLIDRPIRPLFPKGFKNDVHIVATV
LSVNQDNPPEIAAMNGASAALTLSHLPFLGPIGAVVVGLVEDELVINPTIEQAEKSRLHL
VVAGTRDAVMMVEAGAQEVPEEIMIEAITRGHEEVKKIVAFIEEFREEALKLGLAKEKME
VVVEEKAELKEAVTAEAYPLLKEAIEKIIAEKFNKQERDEYLENLKKELTTKFLETYPEE
ELTIKGILDSIQKEIVRQKILKEGIRIDGRKTDEVRPIWCEVGLLPRTHGSGLFTRGQTQ
VLSIVTLGAVGDVQILDDLGIEESKRFMHHYNFPPYSVGEVRPMRGPGRREIGHGALAER
ALEPVIPPEEVFPYTIRIVSEVLESNGSTSMGSVCGSTLALMDAGVPIKAPVAGVAMGLI
KEGDEVAILTDIQGIEDALGDMDFKVAGTKDGITALQMDIKIAGVTRDILTKALAQAREG
RMHILGKMLEVISEPRKELSPYAPRIIFTTVDPEKIRDIIGPGGKIIKKIIDETGVKIDI
EDDGRIFIAAVDKEAGEKALNIIENLTKEIEVGKVYLGKVTRIADFGAFVEVVPGVLGLP
GKEGLVHISQLAHSRVKRVEDVVKEGDQILVKAIGYDNQGRLKLSRKDAIPAEEVREKKN
PPIHKPRREGK
Download sequence
Identical sequences Q3ABA6
gi|78044607|ref|YP_360578.1| WP_011344652.1.88130 WP_011344652.1.931 246194.CHY_1758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]