SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246195.DNO_0564 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246195.DNO_0564
Domain Number 1 Region: 1-227
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.7e-73
Family Decarboxylase 0.000000984
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246195.DNO_0564
Sequence length 229
Comment (Dichelobacter nodosus VCS1703A)
Sequence
MNHSPIIIALDFPQKEPALTCAKQLSPQHCRLKIGSELFTREGAPLIAQLRELGFEIFLD
LKFHDIPNTVAAAVRVAADLGVWMVNVHASGGLAMMQAAKEAATAAKQAPLLTAVTVLTS
FDDAALGSVGVDDLMESQVQRLARLAFTAGLDGVVCSAAEVPVIKKSTAPQFLTVTPGIR
PQQSAHDDQKRVFTPKEALAQGSDYLVIGRPITRAADPAQALNAIMATL
Download sequence
Identical sequences A5EVH6
gi|146329125|ref|YP_001209474.1| 246195.DNO_0564 WP_012030898.1.19569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]