SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246196.MSMEG_4620 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246196.MSMEG_4620
Domain Number 1 Region: 9-131,162-273
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.54e-74
Family Sir2 family of transcriptional regulators 0.0000847
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 246196.MSMEG_4620
Sequence length 282
Comment (Mycobacterium smegmatis MC2 155)
Sequence
MDAPELVALLQGRRIVALTGAGMSTDSGIPDYRGPDSPPSNPMTIQQFTSDPVFRQRYWA
RNHVGWRHMDETQPNAGHRALAAMEASGVVAGVITQNVDLLHTKAGSREVINLHGTYAQV
VCLNPDCGHTMSRAALAVMLEEANPGFLARAESVGGIAVAPDADAMITDTASFVVVDCPM
CGGMLKPDIVYFGDSVPKTRVEQAYSLVDSADALLVAGSSLTVFSGYRFVRHAAARGIPV
GIVNRGPTRGDDLAAVKVHSGCSEMLTLLAGELTRTYTASPG
Download sequence
Identical sequences A0R145 I7GCK7
gi|118472974|ref|YP_888883.1| 246196.MSMEG_4620 WP_011729967.1.100356 WP_011729967.1.19768 WP_011729967.1.23286 WP_011729967.1.56412 WP_011729967.1.74845 YP_888883.1.77314 gi|118472974|ref|YP_888883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]