SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246197.MXAN_4817 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246197.MXAN_4817
Domain Number 1 Region: 48-304
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.34e-59
Family Glycosyl hydrolases family 16 0.0026
Further Details:      
 
Domain Number 2 Region: 311-453
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000312
Family CBM4/9 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 246197.MXAN_4817
Sequence length 455
Comment (Myxococcus xanthus DK 1622)
Sequence
MHKRHALRSMLWAASSLALVGGCSPEPELSDAEALPLVTQEQGERAYDPGPGWNLAWQDD
FTGNSLNSANWTVLTSNFDPVTNNCNFGTGELEFPRAQNVTVAGGKLILTAQRTADAPFD
SRCAGYGPRSYYSGRIHSKGKVERRYGKLVASIKVPSGYGMWPAFWTLGANISNVGWPRS
GEIDILEWHSNDASWMKSAAHWFANGAQQSWGTGANRGYSIADGFHTYEVEWTANRMIFR
LDGEIRGNEFAHNEAAFQQNHYILLNLALGGNWYGHPHPDAIGLPWGQTKTMEVEWVRWY
QPGSTPPPASLTNASFENGMTGWATWSPNGTEAADFSETYNGGRTGAYHLTHWTNGTPFE
VWTYQPVPGLASGTYKVRAWVRKSGGFDLSRLQAKTCGECAPVFTNLGNHGDWTMVETPP
ISVTGGYLELGFHTRATSGNSANFIHMDDVELIRL
Download sequence
Identical sequences Q1D2Z5
gi|108763963|ref|YP_632978.1| 246197.MXAN_4817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]