SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246197.MXAN_5867 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  246197.MXAN_5867
Domain Number - Region: 340-470
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00023
Family Laminin G-like module 0.038
Further Details:      
 
Domain Number - Region: 63-97,134-160,210-259
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0112
Family Glycosyl hydrolases family 16 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 246197.MXAN_5867
Sequence length 478
Comment (Myxococcus xanthus DK 1622)
Sequence
MMGQARRQEKQHESPTESAPRQEPPASTAWVKPTGLTRKGWAVLVGLILVIQFPLIHYAL
LRGQAEVTAKLPYTQDFSDPGVVERDFFSAGGYWRVLQGELLAPGVKNNPLWLQAPLPDD
VAVEFDVRSELPAGDIRVELFGNGVDPASGYVLVQGGWNNSMSVIGRRDMNAPSLDALRR
RAARGGKENVDLKASGFFKENTKVRVELRGQPVQVGRTYHWRIERRGSLLRWFVDGELML
ELDDPFPLKGPGQDRLGLSGFESQIFYDNLRVDTPDRMPFTAAPRAPTPPPGPYADDFNR
DTLGDAWNATNPSAVKLVDGALVVELMHNRPVWLKQPIPTNATIEFDAWTDNPEGDIKVE
VWGDGRSFYAGDLRLQYTATGYVIIFGGWRNTQSAIARQNEHANDRAVRDGAAVVPGKRH
HIKITRNGGTLAWELDGQPYLTLKDPVPLEGPRNQYFGFSGWKNRVHFDNLKIQPLGP
Download sequence
Identical sequences Q1D019
246197.MXAN_5867 gi|108759020|ref|YP_634004.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]