SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246200.SPO0894 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  246200.SPO0894
Domain Number - Region: 35-76
Classification Level Classification E-value
Superfamily Prefoldin 0.0188
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 246200.SPO0894
Sequence length 83
Comment (Ruegeria pomeroyi DSS 3)
Sequence
METDLRVARMNAPSDMSMKTDEVLRVELEVFRRQHRDLDEAIAALEEKGTADQLTVKRLK
KQKLRLKDIIAMLEDRLTPDIIA
Download sequence
Identical sequences Q5LV08
gi|56695796|ref|YP_166147.1| 246200.SPO0894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]