SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246200.SPO2892 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246200.SPO2892
Domain Number 1 Region: 41-154
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 8.64e-19
Family Single-domain sulfurtransferase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 246200.SPO2892
Sequence length 160
Comment (Ruegeria pomeroyi DSS 3)
Sequence
MSGTAILTHPMGRRAVLALGGAVLAGLAVREYLLTPEDFAGGDLSVEAAHEQANAGAVLL
VDIRRPDEWASTGVGAGAQPLDMRRADFVAALDQLAGGDRARPIALICARGVRSARLANQ
LAQAGFTSIIDVPEGMLGSRAGPGWLRAGLPVVAHAEAQE
Download sequence
Identical sequences Q5LPF6
gi|56697730|ref|YP_168100.1| 246200.SPO2892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]