SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246200.SPO3196 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246200.SPO3196
Domain Number 1 Region: 93-183
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0000000000201
Family RecO C-terminal domain-like 0.061
Further Details:      
 
Domain Number 2 Region: 2-69
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000308
Family RecO N-terminal domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246200.SPO3196
Sequence length 241
Comment (Ruegeria pomeroyi DSS 3)
Sequence
MDWRDQGILLAVRRHGETSAIIDTFTASHGRHAGVVRGGTSRRIAPILQPGAQLDLSWRA
RLEDHLGSFTVEPLRSRAAAAMSGRLALAGLNAVVSLLSFCLPEREAHPRLYKQSEQLLD
LLGQDEIWPLAYLRWELALLDTLGFGLDLSSCAVTGNSDDLVYVSPRSGRAVSAGAAGEW
AERLLPLPPCLRGEGPAPDPEIAQALRTTGHFLEHRVAPALGHAPLPQARGRLLDLISRL
P
Download sequence
Identical sequences Q5LNK7
gi|56698028|ref|YP_168399.1| WP_011048886.1.46818 246200.SPO3196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]