SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 247156.nfa33990 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  247156.nfa33990
Domain Number - Region: 17-46
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.049
Family Serum paraoxonase/arylesterase 1, PON1 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 247156.nfa33990
Sequence length 50
Comment (Nocardia farcinica IFM10152)
Sequence
MPRDRSGSTARAPPATTTFAARKISSGYSWPECPCWHEGTFWFQDMYTEP
Download sequence
Identical sequences Q5YU95
gi|54025368|ref|YP_119610.1| 247156.nfa33990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]